• Gene id: 10785

Gene Summary

• Gene Symbol: WDR4   Gene   UCSC   Ensembl
• Aliases: GAMOS6, MIGSB, TRM82, TRMT82, hWH
• Gene name: WD repeat domain 4
• Alternate names: tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4, TRM82 tRNA methyltransferase 82 homolog, WD repeat-containing protein 4, protein Wuho homolog, tRNA (guanine-N(7)-)-methyltransferase subunit WDR4,
• Gene location: 21q22.3 (4979419: 4985322)     Exons: 5     NC_000003.12
• Gene summary(Entrez): This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein com
• OMIM: 605924

Protein Summary

• Protein general information: P57081  
  • Name: tRNA (guanine N(7) ) methyltransferase non catalytic subunit WDR4 (Protein Wuho homolog) (hWH) (WD repeat containing protein 4)
  • Length: 412  
  • Mass: 45490
• Sequence:

  MAGSVGLALCGQTLVVRGGSRFLATSIASSDDDSLFIYDCSAAEKKSQENKGEDAPLDQGSGAILASTFSKSGSY
  FALTDDSKRLILFRTKPWQCLSVRTVARRCTALTFIASEEKVLVADKSGDVYSFSVLEPHGCGRLELGHLSMLLD
  VAVSPDDRFILTADRDEKIRVSWAAAPHSIESFCLGHTEFVSRISVVPTQPGLLLSSSGDGTLRLWEYRSGRQLH
  CCHLASLQELVDPQAPQKFAASRIAFWCQENCVALLCDGTPVVYIFQLDARRQQLVYRQQLAFQHQVWDVAFEET
  QGLWVLQDCQEAPLVLYRPVGDQWQSVPESTVLKKVSGVLRGNWAMLEGSAGADASFSSLYKATFDNVTSYLKKK
  EERLQQQLEKKQRRRSPPPGPDGHAKKMRPGEATLSC

• Structural information:
  • Interpro: IPR028884  IPR015943  IPR001680  IPR017986  IPR036322  
  • Prosite: PS50082 PS50294
  • DIP: 61919
  • STRING: ENSP00000381266
• Other Databases: GeneCards:  WDR4  Malacards:  WDR4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008176	tRNA (guanine-N7-)-methyltransferase activity	IBA	contributes to
GO:0005829	cytosol	IBA	cellular component
GO:0043527	tRNA methyltransferase complex	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0008176	tRNA (guanine-N7-)-methyltransferase activity	IDA	contributes to
GO:0006400	tRNA modification	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0043527	tRNA methyltransferase complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0036265	RNA (guanine-N7)-methylation	IEA	biological process
GO:0008033	tRNA processing	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0005694	chromosome	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0030488	tRNA methylation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0106004	tRNA (guanine-N7)-methylation	IEA	biological process
GO:0106004	tRNA (guanine-N7)-methylation	IEA	biological process
GO:0005654	nucleoplasm	HDA	cellular component

Diseases

Associated diseases	References
Galloway-Mowat syndrome	KEGG:H01722
Galloway-Mowat syndrome	KEGG:H01722
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray