• Gene id: 10782

Gene Summary

• Gene Symbol: ZNF274   Gene   UCSC   Ensembl
• Aliases: HFB101, ZF2, ZKSCAN19, ZSCAN51
• Gene name: zinc finger protein 274
• Alternate names: neurotrophin receptor-interacting factor homolog, KRAB zinc finger protein HFB101, zinc finger protein HFB101, zinc finger protein with KRAB and SCAN domains 19, zinc finger protein zfp2,
• Gene location: 19q13.43 (58182988: 58213561)     Exons: 5     NC_000019.10
• Gene summary(Entrez): This gene encodes a zinc finger protein containing five C2H2-type zinc finger domains, one or two Kruppel-associated box A (KRAB A) domains, and a leucine-rich domain. The encoded protein has been suggested to be a transcriptional repressor. It localizes
• OMIM: 605467

Protein Summary

• Protein general information: Q96GC6  
  • Name: Neurotrophin receptor interacting factor homolog (Zinc finger protein 274) (Zinc finger protein HFB101) (Zinc finger protein with KRAB and SCAN domains 19) (Zinc finger protein zfp2) (Zf2)
  • Length: 653  
  • Mass: 74177
• Sequence:

  MASRLPTAWSCEPVTFEDVTLGFTPEEWGLLDLKQKSLYREVMLENYRNLVSVEHQLSKPDVVSQLEEAEDFWPV
  ERGIPQDTIPEYPELQLDPKLDPLPAESPLMNIEVVEVLTLNQEVAGPRNAQIQALYAEDGSLSADAPSEQVQQQ
  GKHPGDPEAARQRFRQFRYKDMTGPREALDQLRELCHQWLQPKARSKEQILELLVLEQFLGALPVKLRTWVESQH
  PENCQEVVALVEGVTWMSEEEVLPAGQPAEGTTCCLEVTAQQEEKQEDAAICPVTVLPEEPVTFQDVAVDFSREE
  WGLLGPTQRTEYRDVMLETFGHLVSVGWETTLENKELAPNSDIPEEEPAPSLKVQESSRDCALSSTLEDTLQGGV
  QEVQDTVLKQMESAQEKDLPQKKHFDNRESQANSGALDTNQVSLQKIDNPESQANSGALDTNQVLLHKIPPRKRL
  RKRDSQVKSMKHNSRVKIHQKSCERQKAKEGNGCRKTFSRSTKQITFIRIHKGSQVCRCSECGKIFRNPRYFSVH
  KKIHTGERPYVCQDCGKGFVQSSSLTQHQRVHSGERPFECQECGRTFNDRSAISQHLRTHTGAKPYKCQDCGKAF
  RQSSHLIRHQRTHTGERPYACNKCGKAFTQSSHLIGHQRTHNRTKRKKKQPTS

• Structural information:
  • Protein Domains: (14..8-)
    (/note="KRAB-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00119-)
    (161..24-)
    (/note="SCAN-box)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00187-)
    (287..36-)
    (/note="KRAB-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00119"-)
  • Interpro: IPR001909  IPR036051  IPR003309  IPR038269  IPR036236   IPR013087  
  • Prosite: PS50805 PS50804 PS00028 PS50157
  • CDD: cd07765 cd07936
  • STRING: ENSP00000478533
• Other Databases: GeneCards:  ZNF274  Malacards:  ZNF274

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003682	chromatin binding	IDA	molecular function
GO:0043565	sequence-specific DNA binding	IDA	molecular function
GO:1900112	regulation of histone H3-K9 trimethylation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	TAS	biological process
GO:0005730	nucleolus	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04722	Neurotrophin signaling pathway

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)