• Gene id: 10776

Gene Summary

• Gene Symbol: ARPP19   Gene   UCSC   Ensembl
• Aliases: ARPP-16, ARPP-19, ARPP16, ENSAL
• Gene name: cAMP regulated phosphoprotein 19
• Alternate names: cAMP-regulated phosphoprotein 19, cAMP-regulated phosphoprotein 19kDa, cyclic AMP phosphoprotein, 19 kD,
• Gene location: 15q21.2 (114821642: 114431109)     Exons: 33     NC_000010.11
• Gene summary(Entrez): The 19-kD cAMP-regulated phosphoprotein plays a role in regulating mitosis by inhibiting protein phosphatase-2A (PP2A; see MIM 176915) (summary by Gharbi-Ayachi et al., 2010 [PubMed 21164014]).[supplied by OMIM, Feb 2011]
• OMIM: 605487

Protein Summary

• Protein general information: P56211  
  • Name: cAMP regulated phosphoprotein 19 (ARPP 19)
  • Length: 112  
  • Mass: 12323
• Sequence:

  MSAEVPEAASAEEQKEMEDKVTSPEKAEEAKLKARYPHLGQKPGGSDFLRKRLQKGQKYFDSGDYNMAKAKMKNK
  QLPTAAPDKTEVTGDHIPTPQDLPQRKPSLVASKLAG

• Structural information:
  • Interpro: IPR006760  
  • STRING: ENSP00000455625
• Other Databases: GeneCards:  ARPP19  Malacards:  ARPP19

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0035308	negative regulation of protein dephosphorylation	IBA	biological process
GO:0004864	protein phosphatase inhibitor activity	IBA	molecular function
GO:0000278	mitotic cell cycle	IMP	biological process
GO:0000086	G2/M transition of mitotic cell cycle	IMP	biological process
GO:0051721	protein phosphatase 2A binding	ISS	molecular function
GO:0019212	phosphatase inhibitor activity	ISS	molecular function
GO:0019888	protein phosphatase regulator activity	ISS	molecular function
GO:0051301	cell division	IEA	biological process
GO:0004864	protein phosphatase inhibitor activity	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0043666	regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0032515	negative regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0032515	negative regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0043086	negative regulation of catalytic activity	IEA	biological process
GO:0015459	potassium channel regulator activity	IDA	molecular function
GO:0005102	signaling receptor binding	IDA	molecular function
GO:0045722	positive regulation of gluconeogenesis	IDA	biological process
GO:0046326	positive regulation of glucose import	NAS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881