• Gene id: 10771

Gene Summary

• Gene Symbol: ZMYND11   Gene   UCSC   Ensembl
• Aliases: BRAM1, BS69, MRD30
• Gene name: zinc finger MYND-type containing 11
• Alternate names: zinc finger MYND domain-containing protein 11, adenovirus 5 E1A-binding protein, bone morphogenetic protein receptor-associated molecule 1,
• Gene location: 10p15.3 (130087: 254636)     Exons: 23     NC_000010.11
• Gene summary(Entrez): The protein encoded by this gene was first identified by its ability to bind the adenovirus E1A protein. The protein localizes to the nucleus. It functions as a transcriptional repressor, and expression of E1A inhibits this repression. Alternatively splic
• OMIM: 616597

Protein Summary

• Protein general information: Q15326  
  • Name: Zinc finger MYND domain containing protein 11 (Adenovirus 5 E1A binding protein) (Bone morphogenetic protein receptor associated molecule 1) (Protein BS69)
  • Length: 602  
  • Mass: 70963
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKG
  SKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKK
  KNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLH
  NTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQ
  KEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEA
  ESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEEPEPETEAVSSSQEIPTMPQPIEKVSVSTQTKKLSASSPRM
  LHRSTQTTNDGVCQSMCHDKYTKIFNDFKDRMKSDHKRETERVVREALEKLRSEMEEEKRQAVNKAVANMQGEMD
  RKCKQVKEKCKEEFVEEIKKLATQHKQLISQTKKKQWCYNCEEEAMYHCCWNTSYCSIKCQQEHWHAEHKRTCRR
  KR

• Structural information:
  • Protein Domains: (168..23-)
    (/note="Bromo-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00035-)
    (280..33-)
    (/note="PWWP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00162"-)
  • Interpro: IPR001487  IPR036427  IPR000313  IPR019786  IPR035505   IPR011011  IPR002893  IPR001965  IPR019787  IPR013083  
  • Prosite: PS50014 PS50812 PS01360 PS50865 PS01359 PS50016
  • CDD: cd05841
  • PDB: 4NS5 5HDA
  • PDBsum: 4NS5 5HDA
  • STRING: ENSP00000381053
• Other Databases: GeneCards:  ZMYND11  Malacards:  ZMYND11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051607	defense response to virus	IDA	biological process
GO:0035064	methylated histone binding	IDA	molecular function
GO:0008270	zinc ion binding	IDA	molecular function
GO:0003690	double-stranded DNA binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0035064	methylated histone binding	ISS	molecular function
GO:0034243	regulation of transcription elongation from RNA polymerase II promoter	ISS	biological process
GO:0008270	zinc ion binding	ISS	molecular function
GO:0003714	transcription corepressor activity	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006325	chromatin organization	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016032	viral process	IEA	biological process
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	TAS	biological process
GO:0043124	negative regulation of I-kappaB kinase/NF-kappaB signaling	IMP	biological process
GO:2001237	negative regulation of extrinsic apoptotic signaling pathway	IMP	biological process
GO:0046329	negative regulation of JNK cascade	IMP	biological process

Diseases

Associated diseases	References
Autosomal dominant mental retardation	KEGG:H00773
Autosomal dominant mental retardation	KEGG:H00773
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881