• Gene id: 10769

Gene Summary

• Gene Symbol: PLK2   Gene   UCSC   Ensembl
• Aliases: SNK, hPlk2, hSNK
• Gene name: polo like kinase 2
• Alternate names: serine/threonine-protein kinase PLK2, PLK-2, serine/threonine-protein kinase SNK, serum-inducible kinase,
• Gene location: 5q11.2 (44818128: 44805616)     Exons: 4     NC_000021.9
• Gene summary(Entrez): The protein encoded by this gene is a member of the polo family of serine/threonine protein kinases that have a role in normal cell division. This gene is most abundantly expressed in testis, spleen and fetal tissues, and its expression is inducible by se
• OMIM: 607023

Protein Summary

• Protein general information: Q9NYY3  
  • Name: Serine/threonine protein kinase PLK2 (EC 2.7.11.21) (Polo like kinase 2) (PLK 2) (hPlk2) (Serine/threonine protein kinase SNK) (hSNK) (Serum inducible kinase)
  • Length: 685  
  • Mass: 78237
  • Tissue specificity: Expressed at higher level in the fetal lung, kidney, spleen and heart. {ECO
• Sequence:

  MELLRTITYQPAASTKMCEQALGKGCGADSKKKRPPQPPEESQPPQSQAQVPPAAPHHHHHHSHSGPEISRIIVD
  PTTGKRYCRGKVLGKGGFAKCYEMTDLTNNKVYAAKIIPHSRVAKPHQREKIDKEIELHRILHHKHVVQFYHYFE
  DKENIYILLEYCSRRSMAHILKARKVLTEPEVRYYLRQIVSGLKYLHEQEILHRDLKLGNFFINEAMELKVGDFG
  LAARLEPLEHRRRTICGTPNYLSPEVLNKQGHGCESDIWALGCVMYTMLLGRPPFETTNLKETYRCIREARYTMP
  SSLLAPAKHLIASMLSKNPEDRPSLDDIIRHDFFLQGFTPDRLSSSCCHTVPDFHLSSPAKNFFKKAAAALFGGK
  KDKARYIDTHNRVSKEDEDIYKLRHDLKKTSITQQPSKHRTDEELQPPTTTVARSGTPAVENKQQIGDAIRMIVR
  GTLGSCSSSSECLEDSTMGSVADTVARVLRGCLENMPEADCIPKEQLSTSFQWVTKWVDYSNKYGFGYQLSDHTV
  GVLFNNGAHMSLLPDKKTVHYYAELGQCSVFPATDAPEQFISQVTVLKYFSHYMEENLMDGGDLPSVTDIRRPRL
  YLLQWLKSDKALMMLFNDGTFQVNFYHDHTKIIICSQNEEYLLTYINEDRISTTFRLTTLLMSGCSSELKNRMEY
  ALNMLLQRCN

• Structural information:
  • Protein Domains: (82..33-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159-)
    (510..57-)
    1 (/note="POLO-box)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00154-)
    (606..67-)
    2 (/note="POLO-box)
    (/evidence="ECO:0000255|PROSITE-ProR-)
  • Interpro: IPR011009  IPR042825  IPR033701  IPR033695  IPR000959   IPR036947  IPR000719  IPR017441  IPR008271  
  • Prosite: PS50078 PS00107 PS50011 PS00108
  • CDD: cd13118 cd13117 cd14188
  • PDB: 4I5M 4I5P 4I6B 4I6F 4I6H 4RS6 4XB0
  • PDBsum: 4I5M 4I5P 4I6B 4I6F 4I6H 4RS6 4XB0
  • DIP: 48943
  • STRING: ENSP00000274289
• Other Databases: GeneCards:  PLK2  Malacards:  PLK2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043008	ATP-dependent protein binding	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0045732	positive regulation of protein catabolic process	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0010508	positive regulation of autophagy	IDA	biological process
GO:0048167	regulation of synaptic plasticity	IBA	biological process
GO:0007093	mitotic cell cycle checkpoint	IBA	biological process
GO:0005813	centrosome	IBA	cellular component
GO:0000278	mitotic cell cycle	IBA	biological process
GO:0000082	G1/S transition of mitotic cell cycle	IBA	biological process
GO:0032465	regulation of cytokinesis	IBA	biological process
GO:0005814	centriole	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0000922	spindle pole	IBA	cellular component
GO:0046599	regulation of centriole replication	IDA	biological process
GO:0046599	regulation of centriole replication	IDA	biological process
GO:0046599	regulation of centriole replication	IDA	biological process
GO:0007052	mitotic spindle organization	IDA	biological process
GO:0005813	centrosome	IDA	cellular component
GO:0006468	protein phosphorylation	IDA	biological process
GO:0005814	centriole	IDA	cellular component
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0060291	long-term synaptic potentiation	ISS	biological process
GO:0048167	regulation of synaptic plasticity	ISS	biological process
GO:0048167	regulation of synaptic plasticity	ISS	biological process
GO:0046599	regulation of centriole replication	IMP	biological process
GO:0043066	negative regulation of apoptotic process	ISS	biological process
GO:0030425	dendrite	ISS	cellular component
GO:0007613	memory	ISS	biological process
GO:0007265	Ras protein signal transduction	ISS	biological process
GO:0007093	mitotic cell cycle checkpoint	ISS	biological process
GO:0000082	G1/S transition of mitotic cell cycle	IMP	biological process
GO:0060292	long-term synaptic depression	ISS	biological process
GO:0032486	Rap protein signal transduction	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006977	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000278	mitotic cell cycle	IEA	biological process
GO:0007093	mitotic cell cycle checkpoint	IEA	biological process
GO:0007613	memory	IEA	biological process
GO:0016525	negative regulation of angiogenesis	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0048167	regulation of synaptic plasticity	IEA	biological process
GO:0090050	positive regulation of cell migration involved in sprouting angiogenesis	IEA	biological process
GO:0007265	Ras protein signal transduction	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0032092	positive regulation of protein binding	IEA	biological process
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0048167	regulation of synaptic plasticity	IEA	biological process
GO:0060291	long-term synaptic potentiation	IEA	biological process
GO:0061000	negative regulation of dendritic spine development	IEA	biological process
GO:0000785	chromatin	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0071866	negative regulation of apoptotic process in bone marrow cell	IEA	biological process
GO:2000773	negative regulation of cellular senescence	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0032486	Rap protein signal transduction	IEA	biological process
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0060292	long-term synaptic depression	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0005814	centriole	IEA	cellular component
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	HMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04068	FoxO signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray