• Gene id: 10768

Gene Summary

• Gene Symbol: AHCYL1   Gene   UCSC   Ensembl
• Aliases: DCAL, IRBIT, PPP1R78, PRO0233, XPVKONA
• Gene name: adenosylhomocysteinase like 1
• Alternate names: S-adenosylhomocysteine hydrolase-like protein 1, DC-expressed AHCY-like molecule, IP(3)Rs binding protein released with IP(3), S-adenosyl homocysteine hydrolase homolog, S-adenosyl-L-homocysteine hydrolase 2, adenosylhomocysteinase 2, adoHcyase 2, dendritic cell,
• Gene location: 1p13.3 (109984764: 110023741)     Exons: 20     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene interacts with inositol 1,4,5-trisphosphate receptor, type 1 and may be involved in the conversion of S-adenosyl-L-homocysteine to L-homocysteine and adenosine. Several transcript variants encoding two different isoforms h
• OMIM: 607826

Protein Summary

• Protein general information: O43865  
  • Name: S adenosylhomocysteine hydrolase like protein 1 (DC expressed AHCY like molecule) (IP(3)Rs binding protein released with IP(3)) (IRBIT) (Putative adenosylhomocysteinase 2) (S adenosyl L homocysteine hydrolase 2) (AdoHcyase 2)
  • Length: 530  
  • Mass: 58951
  • Tissue specificity: Expressed in dendritic cells. {ECO
• Sequence:

  MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFADDMQEFTKFPTKTGRRSLSRSISQSSTDSY
  SSAASYTDSSDDEVSPREKQQTNSKGSSNFCVKNIKQAEFGRREIEIAEQDMSALISLRKRAQGEKPLAGAKIVG
  CTHITAQTAVLIETLCALGAQCRWSACNIYSTQNEVAAALAEAGVAVFAWKGESEDDFWWCIDRCVNMDGWQANM
  ILDDGGDLTHWVYKKYPNVFKKIRGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDG
  LKRTTDVMFGGKQVVVCGYGEVGKGCCAALKALGAIVYITEIDPICALQACMDGFRVVKLNEVIRQVDVVITCTG
  NKNVVTREHLDRMKNSCIVCNMGHSNTEIDVTSLRTPELTWERVRSQVDHVIWPDGKRVVLLAEGRLLNLSCSTV
  PTFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASLHLPSFDAHLTELTDDQAKYLGLNKNGPFKP
  NYYRY

• Structural information:
  • Interpro: IPR042172  IPR000043  IPR015878  IPR036291  IPR020082  
  • Prosite: PS00738 PS00739
  • CDD: cd00401
  • PDB: 3MTG
  • PDBsum: 3MTG
  • STRING: ENSP00000358814
• Other Databases: GeneCards:  AHCYL1  Malacards:  AHCYL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0033353	S-adenosylmethionine cycle	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0004013	adenosylhomocysteinase activity	IBA	NOT|molecular function
GO:0051592	response to calcium ion	IDA	biological process
GO:0038166	angiotensin-activated signaling pathway	IDA	biological process
GO:0031440	regulation of mRNA 3'-end processing	IDA	biological process
GO:0006378	mRNA polyadenylation	IDA	biological process
GO:0010765	positive regulation of sodium ion transport	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0032412	regulation of ion transmembrane transporter activity	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016324	apical plasma membrane	ISS	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0006730	one-carbon metabolic process	IEA	biological process
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:1903779	regulation of cardiac conduction	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0006611	protein export from nucleus	IEA	biological process
GO:0010765	positive regulation of sodium ion transport	IEA	biological process
GO:0042045	epithelial fluid transport	IEA	biological process
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0044070	regulation of anion transport	IEA	biological process
GO:0006378	mRNA polyadenylation	IEA	biological process
GO:0031440	regulation of mRNA 3'-end processing	IEA	biological process
GO:0032412	regulation of ion transmembrane transporter activity	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00270	Cysteine and methionine metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881