• Gene id: 10744

Gene Summary

• Gene Symbol: PTTG2   Gene   UCSC   Ensembl
• Gene name: pituitary tumor-transforming 2
• Alternate names: securin-2, pituitary tumor-transforming gene 2 protein,
• Gene location: 4p14 (37960397: 37961127)     Exons: 1     NC_000004.12
• OMIM: 604231

Protein Summary

• Protein general information: Q9NZH5  
  • Name: Securin 2 (Pituitary tumor transforming gene 2 protein)
  • Length: 202  
  • Mass: 22302
  • Tissue specificity: Expressed at low levels in the pituitary, liver, spleen, prostate, testis, ovary, small intestine and colon. Also expressed in various pituitary, testicular, liver and ovarian tumors. {ECO
• Sequence:

  MATLIYVDKEIGEPGTRVAAKDVLKLESRPSIKALDGISQVLTRRFGKTYDAPSALPKATRKALGTVNRATEKSV
  KTNGPRKQKQPSFSAKKMTEKTVKTKSSVPASDDAYPEIEKFFPFNLLDFESFDLPEERQIAHLPLSGVPLMILD
  EEGELEKLFQLGPPSPVKMPSPPWECNLLQSPSSILSTLDVELPAVCYDIDI

• Structural information:
  • Interpro: IPR006940  
  • STRING: ENSP00000424261
• Other Databases: GeneCards:  PTTG2  Malacards:  PTTG2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:2000816	negative regulation of mitotic sister chromatid separation	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0045143	homologous chromosome segregation	IBA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0051276	chromosome organization	IEA	biological process
GO:0017124	SH3 domain binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003674	molecular_function	ND	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05166	Human T-cell leukemia virus 1 infection
hsa04110	Cell cycle
hsa04114	Oocyte meiosis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881