• Gene id: 10738

Gene Summary

• Gene Symbol: RFPL3   Gene   UCSC   Ensembl
• Aliases: RNF120
• Gene name: ret finger protein like 3
• Alternate names: ret finger protein-like 3,
• Gene location: 22q12.3 (32354884: 32361160)     Exons: 4     NC_000022.11

Protein Summary

• Protein general information: O75679  
  • Name: Ret finger protein like 3
  • Length: 317  
  • Mass: 35386
  • Tissue specificity: Expressed during neurogenesis in differentiating human embryonic stem cells and in the developing human neocortex. {ECO
• Sequence:

  MKRLSLVTTNRLSPQGNFLPLCTFPLAVDMAALFQEASSCPVCSDYLEKPMSLECGCTVCLKCINSLQKEPHGED
  LLCCCCSMVSQRNKIRPNRQLERLVSHIKELEPKLKKILQMNPRMRKFQVDMTLDADTANNFLLISDDLRSVRSG
  LITQNRQDLAERFDVSVCILGSPRFTCGRHYWEVDVGTSTEWDLGVCRESVHCKGKIQLTTELGFWTVSLRDGSR
  LSASTVPLTFLLVDRKLQRVGIFLDMGMQNVSFFDAESGSHVYTFRSVSAEEPLRPFLAPSIPPNGDQGVLSICP
  LMNSGTTDAPVRPGEAK

• Structural information:
  • Protein Domains: (107..30-)
    (/note="B30.2/SPRY-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00548"-)
  • Interpro: IPR001870  IPR003879  IPR013320  IPR006574  IPR022723   IPR038908  IPR037960  IPR003877  IPR001841  IPR013083  
  • Prosite: PS50188 PS50089
  • CDD: cd15821
  • STRING: ENSP00000249007
• Other Databases: GeneCards:  RFPL3  Malacards:  RFPL3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000785	chromatin	IBA	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	IBA	biological process
GO:0005654	nucleoplasm	IBA	cellular component
GO:0004842	ubiquitin-protein transferase activity	IBA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq