• Gene id: 10728

Gene Summary

• Gene Symbol: PTGES3   Gene   UCSC   Ensembl
• Aliases: P23, TEBP, cPGES
• Gene name: prostaglandin E synthase 3
• Alternate names: prostaglandin E synthase 3, Hsp90 co-chaperone, cytosolic prostaglandin E synthase, cytosolic prostaglandin E2 synthase, progesterone receptor complex p23, prostaglandin E synthase 3 (cytosolic), telomerase-binding protein p23, unactive progesterone receptor, 23,
• Gene location: 12 (56689574: 56663340)     Exons: 9     NC_000012.12
• Gene summary(Entrez): This gene encodes an enzyme that converts prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2). This protein functions as a co-chaperone with heat shock protein 90 (HSP90), localizing to response elements in DNA and disrupting transcriptional a
• OMIM: 607061

Protein Summary

• Protein general information: Q15185  
  • Name: Prostaglandin E synthase 3 (EC 5.3.99.3) (Cytosolic prostaglandin E2 synthase) (cPGES) (Hsp90 co chaperone) (Progesterone receptor complex p23) (Telomerase binding protein p23)
  • Length: 160  
  • Mass: 18697
• Sequence:

  MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILC
  CLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQD
  SDDEKMPDLE

• Structural information:
  • Protein Domains: (1..9-)
    (/note="CS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00547"-)
  • Interpro: IPR007052  IPR008978  
  • Prosite: PS51203
  • PDB: 1EJF 1LG0
  • PDBsum: 1EJF 1LG0
  • DIP: 279
  • STRING: ENSP00000482075
• Other Databases: GeneCards:  PTGES3  Malacards:  PTGES3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001516	prostaglandin biosynthetic process	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0051087	chaperone binding	IBA	molecular function
GO:0051879	Hsp90 protein binding	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0006457	protein folding	IBA	biological process
GO:0007004	telomere maintenance via telomerase	IBA	biological process
GO:0050220	prostaglandin-E synthase activity	IBA	molecular function
GO:0051131	chaperone-mediated protein complex assembly	IBA	biological process
GO:1905323	telomerase holoenzyme complex assembly	IBA	biological process
GO:0051085	chaperone cofactor-dependent protein refolding	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006693	prostaglandin metabolic process	IEA	biological process
GO:0006633	fatty acid biosynthetic process	IEA	biological process
GO:0001516	prostaglandin biosynthetic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016853	isomerase activity	IEA	molecular function
GO:0007165	signal transduction	TAS	biological process
GO:0050220	prostaglandin-E synthase activity	IEA	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006805	xenobiotic metabolic process	TAS	biological process
GO:0019371	cyclooxygenase pathway	TAS	biological process
GO:1900034	regulation of cellular response to heat	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051879	Hsp90 protein binding	IPI	molecular function
GO:0070182	DNA polymerase binding	IPI	molecular function
GO:0070182	DNA polymerase binding	IPI	molecular function
GO:1905323	telomerase holoenzyme complex assembly	IDA	biological process
GO:0007004	telomere maintenance via telomerase	IDA	biological process
GO:0007004	telomere maintenance via telomerase	IDA	biological process
GO:0007004	telomere maintenance via telomerase	IMP	biological process
GO:0051973	positive regulation of telomerase activity	IDA	biological process
GO:0051973	positive regulation of telomerase activity	IDA	biological process
GO:0042327	positive regulation of phosphorylation	IDA	biological process
GO:0051973	positive regulation of telomerase activity	IMP	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0001516	prostaglandin biosynthetic process	IEA	biological process
GO:0032991	protein-containing complex	IMP	cellular component
GO:0032991	protein-containing complex	IMP	cellular component
GO:0050821	protein stabilization	IMP	biological process
GO:0050821	protein stabilization	IMP	biological process
GO:0051131	chaperone-mediated protein complex assembly	IMP	biological process
GO:0051879	Hsp90 protein binding	IPI	molecular function
GO:0051879	Hsp90 protein binding	IPI	molecular function
GO:0051082	unfolded protein binding	IDA	molecular function
GO:0050220	prostaglandin-E synthase activity	IDA	molecular function
GO:0005697	telomerase holoenzyme complex	IDA	cellular component
GO:0001516	prostaglandin biosynthetic process	IDA	biological process
GO:0000781	chromosome, telomeric region	IC	cellular component
GO:0003720	telomerase activity	IDA	molecular function
GO:0101031	chaperone complex	IDA	cellular component
GO:0005634	nucleus	HDA	cellular component
GO:0000723	telomere maintenance	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00590	Arachidonic acid metabolism

Diseases

Associated diseases	References
Breast cancer	PMID:20847343
Atherosclerosis	PMID:14736553
Oligodendroglioma	PMID:19347995
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881