• Gene id: 10718

Gene Summary

• Gene Symbol: NRG3   Gene   UCSC   Ensembl
• Aliases: HRG3, pro-NRG3
• Gene name: neuregulin 3
• Alternate names: pro-neuregulin-3, membrane-bound isoform, neuregulin-3-like polypeptide,
• Gene location: 10q23.1 (81875189: 82989978)     Exons: 21     NC_000010.11
• Gene summary(Entrez): This gene is a member of the neuregulin gene family. This gene family encodes ligands for the transmembrane tyrosine kinase receptors ERBB3 and ERBB4 - members of the epidermal growth factor receptor family. Ligand binding activates intracellular signalin
• OMIM: 605533

Protein Summary

• Protein general information: P56975  
  • Name: Pro neuregulin 3, membrane bound isoform (Pro NRG3) [Cleaved into: Neuregulin 3 (NRG 3)]
  • Length: 720  
  • Mass: 77901
  • Tissue specificity: Highly expressed in most regions of the brain with the exception of corpus callosum. Expressed at lower level in testis. Not detected in heart, placenta, lung, liver, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, ovary,
• Sequence:

  MSEGAAAASPPGAASAAAASAEEGTAAAAAAAAAGGGPDGGGEGAAEPPRELRCSDCIVWNRQQTWLCVVPLFIG
  FIGLGLSLMLLKWIVVGSVKEYVPTDLVDSKGMGQDPFFLSKPSSFPKAMETTTTTTSTTSPATPSAGGAASSRT
  PNRISTRLTTITRAPTRFPGHRVPIRASPRSTTARNTAAPATVPSTTAPFFSSSTLGSRPPVPGTPSTQAMPSWP
  TAAYATSSYLHDSTPSWTLSPFQDAASSSSSSSSSATTTTPETSTSPKFHTTTYSTERSEHFKPCRDKDLAYCLN
  DGECFVIETLTGSHKHCRCKEGYQGVRCDQFLPKTDSILSDPTDHLGIEFMESEEVYQRQVLSISCIIFGIVIVG
  MFCAAFYFKSKKQAKQIQEQLKVPQNGKSYSLKASSTMAKSENLVKSHVQLQNYSKVERHPVTALEKMMESSFVG
  PQSFPEVPSPDRGSQSVKHHRSLSSCCSPGQRSGMLHRNAFRRTPPSPRSRLGGIVGPAYQQLEESRIPDQDTIP
  CQGIEVRKTISHLPIQLWCVERPLDLKYSSSGLKTQRNTSINMQLPSRETNPYFNSLEQKDLVGYSSTRASSVPI
  IPSVGLEETCLQMPGISEVKSIKWCKNSYSADVVNVSIPVSDCLIAEQQEVKILLETVQEQIRILTDARRSEDYE
  LASVETEDSASENTAFLPLSPTAKSEREAQFVLRNEIQRDSALTK

• Structural information:
  • Protein Domains: (286..32-)
    (/note="EGF-like-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00076"-)
  • Interpro: IPR013032  IPR000742  IPR040180  
  • Prosite: PS00022 PS01186 PS50026
  • STRING: ENSP00000361214
• Other Databases: GeneCards:  NRG3  Malacards:  NRG3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0048513	animal organ development	IBA	biological process
GO:0045499	chemorepellent activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0005102	signaling receptor binding	IBA	molecular function
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0007399	nervous system development	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0008083	growth factor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0021842	chemorepulsion involved in interneuron migration from the subpallium to the cortex	IEA	biological process
GO:0045499	chemorepellent activity	IEA	molecular function
GO:0060596	mammary placode formation	IEA	biological process
GO:2001223	negative regulation of neuron migration	IEA	biological process
GO:0007389	pattern specification process	IEA	biological process
GO:0030879	mammary gland development	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0007171	activation of transmembrane receptor protein tyrosine kinase activity	IEA	biological process
GO:0005576	extracellular region	NAS	cellular component
GO:0001558	regulation of cell growth	NAS	biological process
GO:0008083	growth factor activity	NAS	molecular function
GO:0005887	integral component of plasma membrane	NAS	cellular component
GO:0030971	receptor tyrosine kinase binding	NAS	molecular function
GO:0030297	transmembrane receptor protein tyrosine kinase activator activity	NAS	molecular function
GO:0050804	modulation of chemical synaptic transmission	IMP	biological process
GO:0098978	glutamatergic synapse	IMP	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04012	ErbB signaling pathway

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)