• Gene id: 10690

Gene Summary

• Gene Symbol: FUT9   Gene   UCSC   Ensembl
• Aliases: Fuc-TIX
• Gene name: fucosyltransferase 9
• Alternate names: 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase 9, alpha-(1,3)-fucosyltransferase 9, fucT-IX, fucosyltransferase 9 (alpha (1,3) fucosyltransferase), fucosyltransferase IX, galactoside 3-L-fucosyltransferase,
• Gene location: 6q16.1 (96015973: 96215611)     Exons: 5     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene belongs to the glycosyltransferase family. It is localized to the golgi, and catalyzes the last step in the biosynthesis of Lewis X (LeX) antigen, the addition of a fucose to precursor polysaccharides. This protein is one
• OMIM: 600028

Protein Summary

• Protein general information: Q9Y231  
  • Name: 4 galactosyl N acetylglucosaminide 3 alpha L fucosyltransferase 9 (EC 2.4.1.152) (Fucosyltransferase 9) (Fucosyltransferase IX) (Fuc TIX) (FucT IX) (Galactoside 3 L fucosyltransferase)
  • Length: 359  
  • Mass: 42071
  • Tissue specificity: Strongly expressed in forebrain and stomach, lower expression in spleen and peripheral blood leukocytes, and no expression in small intestine, colon, liver, lung, kidney, adrenal cortex or uterus (PubMed
• Sequence:

  MTSTSKGILRPFLIVCIILGCFMACLLIYIKPTNSWIFSPMESASSVLKMKNFFSTKTDYFNETTILVWVWPFGQ
  TFDLTSCQAMFNIQGCHLTTDRSLYNKSHAVLIHHRDISWDLTNLPQQARPPFQKWIWMNLESPTHTPQKSGIEH
  LFNLTLTYRRDSDIQVPYGFLTVSTNPFVFEVPSKEKLVCWVVSNWNPEHARVKYYNELSKSIEIHTYGQAFGEY
  VNDKNLIPTISTCKFYLSFENSIHKDYITEKLYNAFLAGSVPVVLGPSRENYENYIPADSFIHVEDYNSPSELAK
  YLKEVDKNNKLYLSYFNWRKDFTVNLPRFWESHACLACDHVKRHQEYKSVGNLEKWFWN

• Structural information:
  • Interpro: IPR031481  IPR001503  IPR038577  
  • STRING: ENSP00000302599
• Other Databases: GeneCards:  FUT9  Malacards:  FUT9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0036065	fucosylation	IBA	biological process
GO:0046920	alpha-(1->3)-fucosyltransferase activity	IBA	molecular function
GO:0032588	trans-Golgi network membrane	IDA	cellular component
GO:0030182	neuron differentiation	IDA	biological process
GO:0036065	fucosylation	IDA	biological process
GO:0005802	trans-Golgi network	IDA	cellular component
GO:0017083	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity	IDA	molecular function
GO:0017083	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity	IDA	molecular function
GO:0033692	cellular polysaccharide biosynthetic process	ISS	biological process
GO:1903037	regulation of leukocyte cell-cell adhesion	IMP	biological process
GO:0017083	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity	IMP	molecular function
GO:0017083	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity	IMP	molecular function
GO:0010976	positive regulation of neuron projection development	IMP	biological process
GO:0017083	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity	IMP	molecular function
GO:1903236	regulation of leukocyte tethering or rolling	IMP	biological process
GO:0006486	protein glycosylation	IEA	biological process
GO:0008417	fucosyltransferase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0008417	fucosyltransferase activity	TAS	molecular function
GO:0005975	carbohydrate metabolic process	TAS	biological process
GO:0017083	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0046920	alpha-(1->3)-fucosyltransferase activity	IEA	molecular function
GO:0036065	fucosylation	IEA	biological process
GO:0017083	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity	IEA	molecular function
GO:0007399	nervous system development	IEA	biological process
GO:0033692	cellular polysaccharide biosynthetic process	IEA	biological process
GO:0006486	protein glycosylation	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0006486	protein glycosylation	IEA	biological process
GO:0042355	L-fucose catabolic process	NAS	biological process
GO:0006486	protein glycosylation	TAS	biological process
GO:0005794	Golgi apparatus	TAS	cellular component
GO:0046920	alpha-(1->3)-fucosyltransferase activity	TAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00601	Glycosphingolipid biosynthesis - lacto and neolacto series
hsa00515	Mannose type O-glycan biosynthesis
hsa00603	Glycosphingolipid biosynthesis - globo and isoglobo series

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray