• Gene id: 1069

Gene Summary

• Gene Symbol: CETN2   Gene   UCSC   Ensembl
• Aliases: CALT, CEN2
• Gene name: centrin 2
• Alternate names: centrin-2, caltractin (20kD calcium-binding protein), centrin, EF-hand protein, 2,
• Gene location: Xq28 (152830756: 152826993)     Exons: 5     NC_000023.11
• Gene summary(Entrez): Caltractin belongs to a family of calcium-binding proteins and is a structural component of the centrosome. The high level of conservation from algae to humans and its association with the centrosome suggested that caltractin plays a fundamental role in
• OMIM: 300006

Protein Summary

• Protein general information: P41208  
  • Name: Centrin 2 (Caltractin isoform 1)
  • Length: 172  
  • Mass: 19738
• Sequence:

  MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISE
  IDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEAD
  RDGDGEVSEQEFLRIMKKTSLY

• Structural information:
  • Protein Domains: (28..6-)
    (/note="EF-hand-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (64..9-)
    (/note="EF-hand-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (101..13-)
    (/note="EF-hand-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU004-)
  • Interpro: IPR037629  IPR011992  IPR018247  IPR002048  IPR000629  
  • Prosite: PS00018 PS50222
  • CDD: cd00051
  • PDB: 1M39 1ZMZ 2A4J 2GGM 2K2I 2OBH
  • PDBsum: 1M39 1ZMZ 2A4J 2GGM 2K2I 2OBH
  • STRING: ENSP00000359300
• Other Databases: GeneCards:  CETN2  Malacards:  CETN2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000278	mitotic cell cycle	IBA	biological process
GO:0005509	calcium ion binding	IBA	molecular function
GO:0005813	centrosome	IBA	cellular component
GO:0006289	nucleotide-excision repair	IBA	biological process
GO:0007099	centriole replication	IBA	biological process
GO:0005814	centriole	IBA	cellular component
GO:0006289	nucleotide-excision repair	IDA	biological process
GO:0005813	centrosome	IDA	cellular component
GO:0071942	XPC complex	IDA	cellular component
GO:0044615	nuclear pore nuclear basket	IDA	cellular component
GO:0070390	transcription export complex 2	IDA	cellular component
GO:0005814	centriole	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0051301	cell division	IEA	biological process
GO:0005643	nuclear pore	IEA	cellular component
GO:0051028	mRNA transport	IEA	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0005814	centriole	IDA	cellular component
GO:0005814	centriole	IDA	cellular component
GO:0000086	G2/M transition of mitotic cell cycle	TAS	biological process
GO:0000715	nucleotide-excision repair, DNA damage recognition	TAS	biological process
GO:0000717	nucleotide-excision repair, DNA duplex unwinding	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006294	nucleotide-excision repair, preincision complex assembly	TAS	biological process
GO:0006294	nucleotide-excision repair, preincision complex assembly	TAS	biological process
GO:0010389	regulation of G2/M transition of mitotic cell cycle	TAS	biological process
GO:0070911	global genome nucleotide-excision repair	TAS	biological process
GO:0097711	ciliary basal body-plasma membrane docking	TAS	biological process
GO:0005622	intracellular	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0036064	ciliary basal body	IEA	cellular component
GO:0032795	heterotrimeric G-protein binding	IEA	molecular function
GO:0008017	microtubule binding	IEA	molecular function
GO:0007283	spermatogenesis	IEA	biological process
GO:0005813	centrosome	IEA	cellular component
GO:0005813	centrosome	IEA	cellular component
GO:0032391	photoreceptor connecting cilium	IEA	cellular component
GO:0031683	G-protein beta/gamma-subunit complex binding	IEA	molecular function
GO:0005929	cilium	IEA	cellular component
GO:0005814	centriole	IEA	cellular component
GO:0005643	nuclear pore	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005814	centriole	IEA	cellular component
GO:0005635	nuclear envelope	IEA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005814	centriole	IDA	cellular component
GO:0007099	centriole replication	IMP	biological process
GO:0000278	mitotic cell cycle	NAS	biological process
GO:0005813	centrosome	NAS	cellular component
GO:0032465	regulation of cytokinesis	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005509	calcium ion binding	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03420	Nucleotide excision repair

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray