• Gene id: 10681

Gene Summary

• Gene Symbol: GNB5   Gene   UCSC   Ensembl
• Aliases: GB5, IDDCA, LADCI, gbeta5
• Gene name: G protein subunit beta 5
• Alternate names: guanine nucleotide-binding protein subunit beta-5, G protein, beta subunit 5L, guanine nucleotide binding protein (G protein), beta 5, guanine nucleotide-binding protein, beta subunit 5L, transducin beta chain 5,
• Gene location: 15q21.2 (65014159: 65022183)     Exons: 5     NC_000011.10
• Gene summary(Entrez): Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene enc
• OMIM: 604447

Protein Summary

• Protein general information: O14775  
  • Name: Guanine nucleotide binding protein subunit beta 5 (Gbeta5) (Transducin beta chain 5)
  • Length: 395  
  • Mass: 43566
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MCDQTFLVNVFGSCDKCFKQRALRPVFKKSQQLSYCSTCAEIMATEGLHENETLASLKSEAESLKGKLEEERAKL
  HDVELHQVAERVEALGQFVMKTRRTLKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDSFTTNKEHAVTMPCTWV
  MACAYAPSGCAIACGGLDNKCSVYPLTFDKNENMAAKKKSVAMHTNYLSACSFTNSDMQILTASGDGTCALWDVE
  SGQLLQSFHGHGADVLCLDLAPSETGNTFVSGGCDKKAMVWDMRSGQCVQAFETHESDINSVRYYPSGDAFASGS
  DDATCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGSRVSILFGHENRVSTLRV
  SPDGTAFCSGSWDHTLRVWA

• Structural information:
  • Interpro: IPR020472  IPR001632  IPR016346  IPR015943  IPR001680   IPR019775  IPR017986  IPR036322  
  • Prosite: PS00678 PS50082 PS50294
  • STRING: ENSP00000261837
• Other Databases: GeneCards:  GNB5  Malacards:  GNB5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007212	dopamine receptor signaling pathway	IBA	biological process
GO:0043547	positive regulation of GTPase activity	IBA	biological process
GO:0031682	G-protein gamma-subunit binding	IBA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0005834	heterotrimeric G-protein complex	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005096	GTPase activator activity	IBA	contributes to
GO:0007212	dopamine receptor signaling pathway	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0005096	GTPase activator activity	IDA	contributes to
GO:0005096	GTPase activator activity	IDA	molecular function
GO:0043547	positive regulation of GTPase activity	IDA	biological process
GO:1902773	GTPase activator complex	TAS	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006457	protein folding	TAS	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0098793	presynapse	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:1901386	negative regulation of voltage-gated calcium channel activity	IDA	biological process
GO:1901386	negative regulation of voltage-gated calcium channel activity	IDA	biological process
GO:0051087	chaperone binding	IPI	molecular function
GO:0031682	G-protein gamma-subunit binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007165	signal transduction	NAS	biological process
GO:0031682	G-protein gamma-subunit binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003924	GTPase activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04151	PI3K-Akt signaling pathway
hsa04014	Ras signaling pathway
hsa05163	Human cytomegalovirus infection
hsa04062	Chemokine signaling pathway
hsa05034	Alcoholism
hsa05170	Human immunodeficiency virus 1 infection
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa04723	Retrograde endocannabinoid signaling
hsa04371	Apelin signaling pathway
hsa04728	Dopaminergic synapse
hsa04724	Glutamatergic synapse
hsa04926	Relaxin signaling pathway
hsa04725	Cholinergic synapse
hsa04726	Serotonergic synapse
hsa05032	Morphine addiction
hsa04727	GABAergic synapse
hsa04713	Circadian entrainment

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray