• Gene id: 1068

Gene Summary

• Gene Symbol: CETN1   Gene   UCSC   Ensembl
• Aliases: CEN1, CETN
• Gene name: centrin 1
• Alternate names: centrin-1, EF-hand protein, calcium binding protein, caltractin, centrin, EF-hand protein, 1, testicular tissue protein Li 37,
• Gene location: 18p11.32 (201982647: 202006142)     Exons: 12     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene plays important roles in the determination of centrosome position and segregation, and in the process of microtubule severing. This protein is localized to the centrosome of interphase cells, and redistributes to the regio
• OMIM: 603187

Protein Summary

• Protein general information: Q12798  
  • Name: Centrin 1 (Caltractin isoform 2)
  • Length: 172  
  • Mass: 19570
• Sequence:

  MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISE
  VDREGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGKISFKNLKRVANELGENLTDEELQEMIDEAD
  RDGDGEVNEEEFLRIMKKTSLY

• Structural information:
  • Protein Domains: (28..6-)
    (/note="EF-hand-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (64..9-)
    (/note="EF-hand-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (101..13-)
    (/note="EF-hand-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU004-)
  • Interpro: IPR011992  IPR018247  IPR002048  IPR000629  
  • Prosite: PS00018 PS50222
  • CDD: cd00051
  • STRING: ENSP00000319052
• Other Databases: GeneCards:  CETN1  Malacards:  CETN1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007099	centriole replication	IBA	biological process
GO:0006289	nucleotide-excision repair	IBA	biological process
GO:0005813	centrosome	IBA	cellular component
GO:0005509	calcium ion binding	IBA	molecular function
GO:0000278	mitotic cell cycle	IBA	biological process
GO:0005814	centriole	IBA	cellular component
GO:0032391	photoreceptor connecting cilium	ISS	cellular component
GO:0005509	calcium ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0051301	cell division	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005814	centriole	IDA	cellular component
GO:0005814	centriole	IDA	cellular component
GO:0005813	centrosome	IMP	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005813	centrosome	IEA	cellular component
GO:0008017	microtubule binding	IEA	molecular function
GO:0032795	heterotrimeric G-protein binding	IEA	molecular function
GO:0034605	cellular response to heat	IEA	biological process
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0031683	G-protein beta/gamma-subunit complex binding	IEA	molecular function
GO:0032391	photoreceptor connecting cilium	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0000922	spindle pole	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Male infertility	MIK: 23641067
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray
23641067	Male infertility				Male infertility