• Gene id: 10675

Gene Summary

• Gene Symbol: CSPG5   Gene   UCSC   Ensembl
• Aliases: NGC
• Gene name: chondroitin sulfate proteoglycan 5
• Alternate names: chondroitin sulfate proteoglycan 5, acidic leucine-rich EGF-like domain-containing brain protein, chondroitin sulfate proteoglycan 5 (neuroglycan C),
• Gene location: 3p21.31 (47580239: 47562237)     Exons: 6     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene is a proteoglycan that may function as a neural growth and differentiation factor. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2011]
• OMIM: 618759

Protein Summary

• Protein general information: O95196  
  • Name: Chondroitin sulfate proteoglycan 5 (Acidic leucine rich EGF like domain containing brain protein) (Neuroglycan C)
  • Length: 566  
  • Mass: 60016
  • Tissue specificity: Restricted to brain (at protein level). {ECO
• Sequence:

  MGRAGGGGPGRGPPPLLLFLGAALVLASGAVPAREAGSAVEAEELVKGSPAWEPPANDTREEAGPPAAGEDEASW
  TAPGGELAGPEEVLQESAAVTGTAWLEADSPGLGGVTAEAGSGDAQALPATLQAPHEVLGQSIMPPAIPEATEAS
  GPPSPTPGDKLSPASELPKESPLEVWLNLGGSTPDPQGPELTYPFQGTLEPQPASDIIDIDYFEGLDGEGRGADL
  GSFPGSPGTSENHPDTEGETPSWSLLDLYDDFTPFDESDFYPTTSFYDDLDEEEEEEEDDKDAVGGGDLEDENEL
  LVPTGKPGLGPGTGQPTSRWHAVPPQHTLGSVPGSSIALRPRPGEPGRDLASSENGTECRSGFVRHNGSCRSVCD
  LFPSYCHNGGQCYLVENIGAFCRCNTQDYIWHKGMRCESIITDFQVMCVAVGSAALVLLLLFMMTVFFAKKLYLL
  KTENTKLRRTNKFRTPSELHNDNFSLSTIAEGSHPNVRKLCNTPRTSSPHARALAHYDNVICQDDPSAPHKIQEV
  LKSCLKEEESFNIQNSMSPKLEGGKGDQADLDVNCLQNNLT

• Structural information:
  • Protein Domains: (371..41-)
    (/note="EGF-like"-)
  • Interpro: IPR042382  IPR010555  IPR009505  
  • STRING: ENSP00000373244
• Other Databases: GeneCards:  CSPG5  Malacards:  CSPG5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045202	synapse	IBA	cellular component
GO:0099550	trans-synaptic signaling, modulating synaptic transmission	IBA	biological process
GO:0048858	cell projection morphogenesis	IBA	biological process
GO:1900026	positive regulation of substrate adhesion-dependent cell spreading	ISS	biological process
GO:0106091	glial cell projection elongation	ISS	biological process
GO:0007010	cytoskeleton organization	ISS	biological process
GO:0007399	nervous system development	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0040008	regulation of growth	IEA	biological process
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0016020	membrane	TAS	cellular component
GO:0030206	chondroitin sulfate biosynthetic process	TAS	biological process
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0030207	chondroitin sulfate catabolic process	TAS	biological process
GO:0030208	dermatan sulfate biosynthetic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:2000300	regulation of synaptic vesicle exocytosis	IEA	biological process
GO:0099055	integral component of postsynaptic membrane	IEA	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0099550	trans-synaptic signaling, modulating synaptic transmission	IEA	biological process
GO:0098982	GABA-ergic synapse	IEA	cellular component
GO:0050804	modulation of chemical synaptic transmission	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0097060	synaptic membrane	IEA	cellular component
GO:0009986	cell surface	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0030660	Golgi-associated vesicle membrane	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0046907	intracellular transport	TAS	biological process
GO:0016021	integral component of membrane	TAS	cellular component
GO:0008083	growth factor activity	TAS	molecular function
GO:0007399	nervous system development	TAS	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq