• Gene id: 10673

Gene Summary

• Gene Symbol: TNFSF13B   Gene   UCSC   Ensembl
• Aliases: BAFF, BLYS, CD257, DTL, TALL-1, TALL1, THANK, TNFSF20, TNLG7A, ZTNF4
• Gene name: TNF superfamily member 13b
• Alternate names: tumor necrosis factor ligand superfamily member 13B, ApoL related ligand TALL-1, B-cell-activating factor, B-lymphocyte stimulator, Delta4 BAFF, TNF and ApoL-related leukocyte expressed ligand 1, TNF homolog that activates apoptosis, delta BAFF, dendritic cell-de,
• Gene location: 13q33.3 (108268239: 108308483)     Exons: 49     NC_000013.11
• Gene summary(Entrez): The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptors TNFRSF13B/TACI, TNFRSF17/BCMA, and TNFRSF13C/BAFFR. This cytokine is expressed in B cell lineage cells, a
• OMIM: 603969

Protein Summary

• Protein general information: Q9Y275  
  • Name: Tumor necrosis factor ligand superfamily member 13B (B lymphocyte stimulator) (BLyS) (B cell activating factor) (BAFF) (Dendritic cell derived TNF like molecule) (TNF and APOL related leukocyte expressed ligand 1) (TALL 1) (CD antigen CD257) [Cleaved int
  • Length: 285  
  • Mass: 31223
  • Tissue specificity: Abundantly expressed in peripheral blood Leukocytes and is specifically expressed in monocytes and macrophages. Also found in the spleen, lymph node, bone marrow, T-cells and dendritic cells. A lower expression seen in placenta, heart,
• Sequence:

  MDDSTEREQSRLTSCLKKREEMKLKECVSILPRKESPSVRSSKDGKLLAATLLLALLSCCLTVVSFYQVAALQGD
  LASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAPGEGNSSQNSRNKRAVQGPEETVTQDCLQLI
  ADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELS
  LVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLL

• Structural information:
  • Interpro: IPR006052  IPR008983  
  • Prosite: PS50049
  • CDD: cd00184
  • PDB: 1JH5 1KD7 1KXG 1OQD 1OQE 1OSG 3V56 4V46 4ZCH 5Y9J 6FXN
  • PDBsum: 1JH5 1KD7 1KXG 1OQD 1OQE 1OSG 3V56 4V46 4ZCH 5Y9J 6FXN
  • DIP: 6225
  • STRING: ENSP00000365048
• Other Databases: GeneCards:  TNFSF13B  Malacards:  TNFSF13B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0030890	positive regulation of B cell proliferation	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0005102	signaling receptor binding	IBA	molecular function
GO:0005164	tumor necrosis factor receptor binding	IEA	molecular function
GO:0006955	immune response	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0007165	signal transduction	TAS	biological process
GO:0030890	positive regulation of B cell proliferation	IMP	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0033209	tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0033209	tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042102	positive regulation of T cell proliferation	IEA	biological process
GO:0031296	B cell costimulation	IEA	biological process
GO:0030890	positive regulation of B cell proliferation	IEA	biological process
GO:0001782	B cell homeostasis	IEA	biological process
GO:0050776	regulation of immune response	IEA	biological process
GO:0048305	immunoglobulin secretion	IEA	biological process
GO:0031295	T cell costimulation	IEA	biological process
GO:0002636	positive regulation of germinal center formation	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0030890	positive regulation of B cell proliferation	TAS	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0016021	integral component of membrane	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04064	NF-kappa B signaling pathway
hsa05323	Rheumatoid arthritis
hsa04672	Intestinal immune network for IgA production

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Spermatogenic failure	MIK: 17921478
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R
17921478	Spermatogenic failure			69 samples	Male infertility	Microarray