• Gene id: 10671

Gene Summary

• Gene Symbol: DCTN6   Gene   UCSC   Ensembl
• Aliases: WS-3, WS3, p27
• Gene name: dynactin subunit 6
• Alternate names: dynactin subunit 6, dynactin 6, dynactin subunit p27, novel RGD-containing protein, protein WS-3,
• Gene location: 8p12 (30156368: 30183638)     Exons: 7     NC_000008.11
• Gene summary(Entrez): The protein encoded by this gene contains an RGD (Arg-Gly-Asp) motif in the N-terminal region, which confers adhesive properties to macromolecular proteins like fibronectin. It shares a high degree of sequence similarity with the mouse homolog, which has
• OMIM: 612963

Protein Summary

• Protein general information: O00399  
  • Name: Dynactin subunit 6 (Dynactin subunit p27) (Protein WS 3)
  • Length: 190  
  • Mass: 20747
  • Tissue specificity: Ubiquitous.
• Sequence:

  MAEKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQALIINAYPDNITPDTE
  DPEPKPMIIGTNNVFEVGCYSQAMKMGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPENTVIYGADCLR
  RVQTERPQPQTLQLDFLMKILPNYHHLKKTMKGSSTPVKN

• Structural information:
  • Interpro: IPR027777  IPR001451  IPR011004  
  • PDB: 3TV0
  • PDBsum: 3TV0
  • STRING: ENSP00000221114
• Other Databases: GeneCards:  DCTN6  Malacards:  DCTN6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005813	centrosome	IDA	cellular component
GO:0005869	dynactin complex	IEA	cellular component
GO:0000776	kinetochore	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	TAS	biological process
GO:0019886	antigen processing and presentation of exogenous peptide antigen via MHC class II	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0000777	condensed chromosome kinetochore	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05016	Huntington disease
hsa04962	Vasopressin-regulated water reabsorption

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881