• Gene id: 10670

Gene Summary

• Gene Symbol: RRAGA   Gene   UCSC   Ensembl
• Aliases: FIP-1, FIP1, RAGA
• Gene name: Ras related GTP binding A
• Alternate names: ras-related GTP-binding protein A, adenovirus E3 14.7 kDa-interacting protein 1, adenovirus E3-14.7K interacting protein 1, rag A,
• Gene location: 9p22.1 (19049426: 19051024)     Exons: 1     NC_000009.12
• OMIM: 612194

SNPs

rs3741843

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000012.12   g.10938833C>A
NC_000012.12   g.10938833C>G
NC_000012.12   g.10938833C>T
NC_000012.11   g.11091432C>A
NC_000012.11   g.11091432C>G
NC_000012.11   g.11091432C>T
NT_187658.1   g.137539C>A
NT_187658.1   g.137539C>G
NT_187658.1   g.137539C>T
NW_003571050.1   g

Protein Summary

• Protein general information: Q7L523  
  • Name: Ras related GTP binding protein A (Rag A) (RagA) (EC 3.6.5. ) (Adenovirus E3 14.7 kDa interacting protein 1) (FIP 1)
  • Length: 313  
  • Mass: 36566
  • Tissue specificity: Ubiquitously expressed with highest levels of expression in skeletal muscle, heart, and brain. {ECO
• Sequence:

  MPNTAMKKKVLLMGKSGSGKTSMRSIIFANYIARDTRRLGATIDVEHSHVRFLGNLVLNLWDCGGQDTFMENYFT
  SQRDNIFRNVEVLIYVFDVESRELEKDMHYYQSCLEAILQNSPDAKIFCLVHKMDLVQEDQRDLIFKEREEDLRR
  LSRPLECACFRTSIWDETLYKAWSSIVYQLIPNVQQLEMNLRNFAQIIEADEVLLFERATFLVISHYQCKEQRDV
  HRFEKISNIIKQFKLSCSKLAASFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEKL
  ERVDGPKHSLLMR

• Structural information:
  • Interpro: IPR006762  IPR027417  IPR039397  
  • CDD: cd11384
  • PDB: 5X6V 6CES 6EHR 6NZD 6S6A 6S6D 6SB0 6SB2 6U62 6ULG
  • PDBsum: 5X6V 6CES 6EHR 6NZD 6S6A 6S6D 6SB0 6SB2 6U62 6ULG
  • DIP: 37516
  • STRING: ENSP00000369899
• Other Databases: GeneCards:  RRAGA  Malacards:  RRAGA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003924	GTPase activity	IBA	molecular function
GO:0005764	lysosome	IBA	cellular component
GO:0010506	regulation of autophagy	IBA	biological process
GO:0032008	positive regulation of TOR signaling	IBA	biological process
GO:0034448	EGO complex	IBA	cellular component
GO:0071230	cellular response to amino acid stimulus	IBA	biological process
GO:1990131	Gtr1-Gtr2 GTPase complex	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0009267	cellular response to starvation	IBA	biological process
GO:0005764	lysosome	IDA	cellular component
GO:1990130	GATOR1 complex	IDA	colocalizes with
GO:0071230	cellular response to amino acid stimulus	IMP	biological process
GO:0032008	positive regulation of TOR signaling	NAS	biological process
GO:0034198	cellular response to amino acid starvation	IMP	biological process
GO:1904263	positive regulation of TORC1 signaling	IMP	biological process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0034613	cellular protein localization	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0010507	negative regulation of autophagy	IMP	biological process
GO:0005525	GTP binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005764	lysosome	IEA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016032	viral process	IEA	biological process
GO:0008219	cell death	TAS	biological process
GO:0003924	GTPase activity	IDA	molecular function
GO:0016567	protein ubiquitination	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007050	cell cycle arrest	TAS	biological process
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005764	lysosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0008219	cell death	IDA	biological process
GO:0008219	cell death	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0019048	modulation by virus of host process	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0005525	GTP binding	IDA	molecular function
GO:0051219	phosphoprotein binding	IDA	molecular function
GO:0005525	GTP binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005765	lysosomal membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05131	Shigellosis
hsa04150	mTOR signaling pathway
hsa04140	Autophagy - animal

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)