• Gene id: 10669

Gene Summary

• Gene Symbol: CGREF1   Gene   UCSC   Ensembl
• Aliases: CGR11
• Gene name: cell growth regulator with EF-hand domain 1
• Alternate names: cell growth regulator with EF hand domain protein 1, cell growth regulatory gene 11 protein, hydrophobestin,
• Gene location: 2p23.3 (27119127: 27099352)     Exons: 8     NC_000002.12
• OMIM: 605102

Protein Summary

• Protein general information: Q99674  
  • Name: Cell growth regulator with EF hand domain protein 1 (Cell growth regulatory gene 11 protein) (Hydrophobestin)
  • Length: 318  
  • Mass: 33456
• Sequence:

  MLPLTMTVLILLLLPTGQAAPKDGVTRPDSEVQHQLLPNPFQPGQEQLGLLQSYLKGLGRTEVQLEHLSREQVLL
  YLFALHDYDQSGQLDGLELLSMLTAALAPGAANSPTTNPVILIVDKVLETQDLNGDGLMTPAELINFPGVALRHV
  EPGEPLAPSPQEPQAVGRQSLLAKSPLRQETQEAPGPREEAKGQVEARRESLDPVQEPGGQAEADGDVPGPRGEA
  EGQAEAKGDAPGPRGEAGGQAEAEGDAPGPRGEAGGQAEAEGDAPGPRGEAGGQAEARENGEEAKELPGETLESK
  NTQNDFEVHIVQVENDEI

• Structural information:
  • Protein Domains: (69..10-)
    (/note="EF-hand-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (114..14-)
    (/note="EF-hand-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448"-)
  • Interpro: IPR040139  IPR011992  IPR018247  IPR002048  
  • Prosite: PS00018 PS50222
  • STRING: ENSP00000385452
• Other Databases: GeneCards:  CGREF1  Malacards:  CGREF1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005509	calcium ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0007050	cell cycle arrest	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0008285	negative regulation of cell population proliferation	TAS	biological process
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq