• Gene id: 10668

Gene Summary

• Gene Symbol: CGRRF1   Gene   UCSC   Ensembl
• Aliases: CGR19, RNF197
• Gene name: cell growth regulator with ring finger domain 1
• Alternate names: cell growth regulator with RING finger domain protein 1, RING finger protein 197, cell growth regulatory gene 19 protein,
• Gene location: 14q22.2 (54509895: 54539309)     Exons: 9     NC_000014.9
• OMIM: 606138

Protein Summary

• Protein general information: Q99675  
  • Name: Cell growth regulator with RING finger domain protein 1 (Cell growth regulatory gene 19 protein) (RING finger protein 197)
  • Length: 332  
  • Mass: 38242
  • Tissue specificity: Ubiquitously expressed with high expression in testis and the cerebellum. {ECO
• Sequence:

  MAAVFLVTLYEYSPLFYIAVVFTCFIVTTGLVLGWFGWDVPVILRNSEETQFSTRVFKKQMRQVKNPFGLEITNP
  SSASITTGITLTTDCLEDSLLTCYWGCSVQKLYEALQKHVYCFRISTPQALEDALYSEYLYQEQYFIKKDSKEEI
  YCQLPRDTKIEDFGTVPRSRYPLVALLTLADEDDREIYDIISMVSVIHIPDRTYKLSCRILYQYLLLAQGQFHDL
  KQLFMSANNNFTPSNNSSSEEKNTDRSLLEKVGLSESEVEPSEENSKDCVVCQNGTVNWVLLPCRHTCLCDGCVK
  YFQQCPMCRQFVQESFALCSQKEQDKDKPKTL

• Structural information:
  • Interpro: IPR042496  IPR001841  IPR013083  
  • Prosite: PS50089
  • PDB: 2EA5
  • PDBsum: 2EA5
  • STRING: ENSP00000216420
• Other Databases: GeneCards:  CGRRF1  Malacards:  CGRRF1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030308	negative regulation of cell growth	IBA	biological process
GO:0007050	cell cycle arrest	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0008285	negative regulation of cell population proliferation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)