• Gene id: 10663

Gene Summary

• Gene Symbol: CXCR6   Gene   UCSC   Ensembl
• Aliases: BONZO, CD186, STRL33, TYMSTR
• Gene name: C-X-C motif chemokine receptor 6
• Alternate names: C-X-C chemokine receptor type 6, CDw186, CXC-R6, CXCR-6, G protein-coupled receptor, G-protein coupled receptor STRL33, G-protein coupled receptor bonzo, chemokine (C-X-C motif) receptor 6,
• Gene location: 3p21.31 (45940687: 45948353)     Exons: 4     NC_000003.12
• OMIM: 601743

Protein Summary

• Protein general information: O00574  
  • Name: C X C chemokine receptor type 6 (CXC R6) (CXCR 6) (CDw186) (G protein coupled receptor STRL33) (G protein coupled receptor bonzo) (CD antigen CD186)
  • Length: 342  
  • Mass: 39280
  • Tissue specificity: Expressed in lymphoid tissues and activated T cells.
• Sequence:

  MAEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSLVLVISIFYHKLQSLTDVFLVNLPL
  ADLVFVCTLPFWAYAGIHEWVFGQVMCKSLLGIYTINFYTSMLILTCITVDRFIVVVKATKAYNQQAKRMTWGKV
  TSLLIWVISLLVSLPQIIYGNVFNLDKLICGYHDEAISTVVLATQMTLGFFLPLLTMIVCYSVIIKTLLHAGGFQ
  KHRSLKIIFLVMAVFLLTQMPFNLMKFIRSTHWEYYAMTSFHYTIMVTEAIAYLRACLNPVLYAFVSLKFRKNFW
  KLVKDIGCLPYLGVSHQWKSSEDNSKTFSASHNVEATSMFQL

• Structural information:
  • Interpro: IPR002235  IPR000355  IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • CDD: cd15173
  • STRING: ENSP00000395704
• Other Databases: GeneCards:  CXCR6  Malacards:  CXCR6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019957	C-C chemokine binding	IBA	molecular function
GO:0060326	cell chemotaxis	IBA	biological process
GO:0019956	chemokine binding	IBA	molecular function
GO:0019722	calcium-mediated signaling	IBA	biological process
GO:0016493	C-C chemokine receptor activity	IBA	molecular function
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0007204	positive regulation of cytosolic calcium ion concentration	IBA	biological process
GO:0006955	immune response	IBA	biological process
GO:0006935	chemotaxis	IBA	biological process
GO:0004950	chemokine receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0006935	chemotaxis	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0015026	coreceptor activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016494	C-X-C chemokine receptor activity	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0015026	coreceptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0019079	viral genome replication	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0016494	C-X-C chemokine receptor activity	IEA	molecular function
GO:0019958	C-X-C chemokine binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04062	Chemokine signaling pathway

Diseases

Associated diseases	References
systemic scleroderma	PMID:21303517
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881