• Gene id: 10652

Gene Summary

• Gene Symbol: YKT6   Gene   UCSC   Ensembl
• Gene name: YKT6 v-SNARE homolog
• Alternate names: synaptobrevin homolog YKT6, R-SNARE, SNARE protein Ykt6, YKT6 v-SNARE protein, YKT6, S. cerevisiae, homolog of,
• Gene location: 7p13 (44200977: 44214293)     Exons: 8     NC_000007.14
• Gene summary(Entrez): This gene product is one of the SNARE recognition molecules implicated in vesicular transport between secretory compartments. It is a membrane associated, isoprenylated protein that functions at the endoplasmic reticulum-Golgi transport step. This protein
• OMIM: 609395

Protein Summary

• Protein general information: O15498  
  • Name: Synaptobrevin homolog YKT6 (EC 2.3.1. )
  • Length: 198  
  • Mass: 22418
• Sequence:

  MKLYSLSVLYKGEAKVVLLKAAYDVSSFSFFQRSSVQEFMTFTSQLIVERSSKGTRASVKEQDYLCHVYVRNDSL
  AGVVIADNEYPSRVAFTLLEKVLDEFSKQVDRIDWPVGSPATIHYPALDGHLSRYQNPREADPMTKVQAELDETK
  IILHNTMESLLERGEKLDDLVSKSEVLGTQSKAFYKTARKQNSCCAIM

• Structural information:
  • Protein Domains: (8..12-)
    (/note="Longin-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00231-)
    (138..19-)
    homology (/note="v-SNARE-coiled-coil)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00290"-)
  • Interpro: IPR011012  IPR010908  IPR001388  IPR042855  
  • Prosite: PS50859 PS50892
  • PDB: 6J74 6J7F 6J7X
  • PDBsum: 6J74 6J7F 6J7X
  • STRING: ENSP00000223369
• Other Databases: GeneCards:  YKT6  Malacards:  YKT6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006903	vesicle targeting	IDA	biological process
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IDA	biological process
GO:0006904	vesicle docking involved in exocytosis	IDA	biological process
GO:0019706	protein-cysteine S-palmitoyltransferase activity	IDA	molecular function
GO:0005484	SNAP receptor activity	IDA	molecular function
GO:0005768	endosome	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0031201	SNARE complex	TAS	cellular component
GO:0031201	SNARE complex	ISS	cellular component
GO:0042147	retrograde transport, endosome to Golgi	IDA	biological process
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	TAS	biological process
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane	TAS	cellular component
GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0031201	SNARE complex	IEA	cellular component
GO:0097440	apical dendrite	IEA	cellular component
GO:0097441	basal dendrite	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0045296	cadherin binding	HDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0061025	membrane fusion	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04130	SNARE interactions in vesicular transport

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881