• Gene id: 10651

Gene Summary

• Gene Symbol: MTX2   Gene   UCSC   Ensembl
• Aliases: metaxin-2
• Gene name: metaxin 2
• Alternate names: metaxin-2, mitochondrial outer membrane import complex protein 2,
• Gene location: 2q31.1 (37953668: 37943049)     Exons: 8     NC_000022.11
• Gene summary(Entrez): The protein encoded by this gene is highly similar to the metaxin 2 protein from mouse, which has been shown to interact with the mitochondrial membrane protein metaxin 1. Because of this similarity, it is thought that the encoded protein is peripherally
• OMIM: 608555

Protein Summary

• Protein general information: O75431  
  • Name: Metaxin 2 (Mitochondrial outer membrane import complex protein 2)
  • Length: 263  
  • Mass: 29763
• Sequence:

  MSLVAEAFVSQIAAAEPWPENATLYQQLKGEQILLSDNAASLAVQAFLQMCNLPIKVVCRANAEYMSPSGKVPFI
  HVGNQVVSELGPIVQFVKAKGHSLSDGLEEVQKAEMKAYMELVNNMLLTAELYLQWCDEATVGEITHARYGSPYP
  WPLNHILAYQKQWEVKRKMKAIGWGKKTLDQVLEDVDQCCQALSQRLGTQPYFFNKQPTELDALVFGHLYTILTT
  QLTNDELSEKVKNYSNLLAFCRRIEQHYFEDRGKGRLS

• Structural information:
  • Interpro: IPR036282  IPR040079  IPR033468  IPR019564  IPR036249  
  • STRING: ENSP00000249442
• Other Databases: GeneCards:  MTX2  Malacards:  MTX2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005739	mitochondrion	IDA	cellular component
GO:0001401	SAM complex	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0006839	mitochondrial transport	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0007007	inner mitochondrial membrane organization	IC	biological process
GO:0001401	SAM complex	HDA	cellular component
GO:0140275	MIB complex	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881