• Gene id: 10648

Gene Summary

• Gene Symbol: SCGB1D1   Gene   UCSC   Ensembl
• Aliases: LIPA, LPHA, LPNA
• Gene name: secretoglobin family 1D member 1
• Alternate names: secretoglobin family 1D member 1, lipophilin A (uteroglobin family member), lipophilin-A, prostatein-like lipophilin A,
• Gene location: 11q12.3 (62190215: 62193538)     Exons: 3     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the lipophilin subfamily, part of the uteroglobin superfamily, and is an ortholog of prostatein, the major secretory glycoprotein of the rat ventral prostate gland. This gene product represents one component
• OMIM: 615060

Protein Summary

• Protein general information: O95968  
  • Name: Secretoglobin family 1D member 1 (Lipophilin A)
  • Length: 90  
  • Mass: 9898
  • Tissue specificity: Expressed in lachrymal gland, thymus, kidney, testis, ovary and salivary gland.
• Sequence:

  MRLSVCLLLLTLALCCYRANAVVCQALGSEITGFLLAGKPVFKFQLAKFKAPLEAVAAKMEVKKCVDTMAYEKRV
  LITKTLGKIAEKCDR

• Structural information:
  • Interpro: IPR016126  IPR035960  
  • Prosite: PS51311
  • CDD: cd00633
  • STRING: ENSP00000303070
• Other Databases: GeneCards:  SCGB1D1  Malacards:  SCGB1D1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	HDA	cellular component
GO:0005615	extracellular space	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)