• Gene id: 10647

Gene Summary

• Gene Symbol: SCGB1D2   Gene   UCSC   Ensembl
• Aliases: LIPB, LPHB, LPNB
• Gene name: secretoglobin family 1D member 2
• Alternate names: secretoglobin family 1D member 2, lipophilin-B, prostatein-like lipophilin B,
• Gene location: 11q12.3 (62242238: 62244811)     Exons: 3     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the lipophilin subfamily, part of the uteroglobin superfamily, and is an ortholog of prostatein, the major secretory glycoprotein of the rat ventral prostate gland. Lipophilin gene products are widely expres

Protein Summary

• Protein general information: O95969  
  • Name: Secretoglobin family 1D member 2 (Lipophilin B)
  • Length: 90  
  • Mass: 9925
  • Tissue specificity: Highest expression was found in skeletal muscle. Expressed as well in thymus, trachea, kidney, steroid responsive tissues (prostate, testis, uterus, breast and ovary) and salivary gland.
• Sequence:

  MKLSVCLLLVTLALCCYQANAEFCPALVSELLDFFFISEPLFKLSLAKFDAPPEAVAAKLGVKRCTDQMSLQKRS
  LIAEVLVKILKKCSV

• Structural information:
  • Interpro: IPR016126  IPR035960  
  • Prosite: PS51311
  • CDD: cd00633
  • STRING: ENSP00000244926
• Other Databases: GeneCards:  SCGB1D2  Malacards:  SCGB1D2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881