• Gene id: 10643

Gene Summary

• Gene Symbol: IGF2BP3   Gene   UCSC   Ensembl
• Aliases: CT98, IMP-3, IMP3, KOC, KOC1, VICKZ3
• Gene name: insulin like growth factor 2 mRNA binding protein 3
• Alternate names: insulin-like growth factor 2 mRNA-binding protein 3, IGF-II mRNA-binding protein 3, IGF2 mRNA-binding protein 3, KH domain containing protein overexpressed in cancer, VICKZ family member 3, cancer/testis antigen 98,
• Gene location: 7p15.3 (23470673: 23310208)     Exons: 18     NC_000007.14
• Gene summary(Entrez): The protein encoded by this gene is primarily found in the nucleolus, where it can bind to the 5' UTR of the insulin-like growth factor II leader 3 mRNA and may repress translation of insulin-like growth factor II during late development. The encoded prot
• OMIM: 601576

Protein Summary

• Protein general information: O00425  
  • Name: Insulin like growth factor 2 mRNA binding protein 3 (IGF2 mRNA binding protein 3) (IMP 3) (IGF II mRNA binding protein 3) (KH domain containing protein overexpressed in cancer) (hKOC) (VICKZ family member 3)
  • Length: 579  
  • Mass: 63705
  • Tissue specificity: Expressed in fetal liver, fetal lung, fetal kidney, fetal thymus, fetal placenta, fetal follicles of ovary and gonocytes of testis, growing oocytes, spermatogonia and semen (at protein level). Expressed in cervix adenocarcinoma, in tes
• Sequence:

  MNKLYIGNLSENAAPSDLESIFKDAKIPVSGPFLVKTGYAFVDCPDESWALKAIEALSGKIELHGKPIEVEHSVP
  KRQRIRKLQIRNIPPHLQWEVLDSLLVQYGVVESCEQVNTDSETAVVNVTYSSKDQARQALDKLNGFQLENFTLK
  VAYIPDEMAAQQNPLQQPRGRRGLGQRGSSRQGSPGSVSKQKPCDLPLRLLVPTQFVGAIIGKEGATIRNITKQT
  QSKIDVHRKENAGAAEKSITILSTPEGTSAACKSILEIMHKEAQDIKFTEEIPLKILAHNNFVGRLIGKEGRNLK
  KIEQDTDTKITISPLQELTLYNPERTITVKGNVETCAKAEEEIMKKIRESYENDIASMNLQAHLIPGLNLNALGL
  FPPTSGMPPPTSGPPSAMTPPYPQFEQSETETVHLFIPALSVGAIIGKQGQHIKQLSRFAGASIKIAPAEAPDAK
  VRMVIITGPPEAQFKAQGRIYGKIKEENFVSPKEEVKLEAHIRVPSFAAGRVIGKGGKTVNELQNLSSAEVVVPR
  DQTPDENDQVVVKITGHFYACQVAQRKIQEILTQVKQHQQQKALQSGPPQSRRK

• Structural information:
  • Protein Domains: (2..7-)
    (/note="RRM-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (81..15-)
    (/note="RRM-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (195..26-)
    (/note="KH-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00117-)
    (2-)
  • Interpro: IPR034844  IPR004087  IPR004088  IPR036612  IPR012677   IPR035979  IPR000504  
  • Prosite: PS50084 PS50102
  • CDD: cd12630
  • PDB: 2E44 6FQ1 6FQR 6GQE 6GX6
  • PDBsum: 2E44 6FQ1 6FQR 6GQE 6GX6
  • DIP: 44171
  • STRING: ENSP00000258729
• Other Databases: GeneCards:  IGF2BP3  Malacards:  IGF2BP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003730	mRNA 3'-UTR binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0007399	nervous system development	IBA	biological process
GO:0010468	regulation of gene expression	IBA	biological process
GO:0003729	mRNA binding	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0003730	mRNA 3'-UTR binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0051028	mRNA transport	IEA	biological process
GO:0006417	regulation of translation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0006412	translation	TAS	biological process
GO:0009653	anatomical structure morphogenesis	TAS	biological process
GO:0003723	RNA binding	TAS	molecular function
GO:0005737	cytoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043488	regulation of mRNA stability	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0048027	mRNA 5'-UTR binding	IDA	molecular function
GO:0045182	translation regulator activity	ISS	molecular function
GO:0042035	regulation of cytokine biosynthetic process	IC	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0017148	negative regulation of translation	ISS	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R