• Gene id: 10642

Gene Summary

• Gene Symbol: IGF2BP1   Gene   UCSC   Ensembl
• Aliases: CRD-BP, CRDBP, IMP-1, IMP1, VICKZ1, ZBP1
• Gene name: insulin like growth factor 2 mRNA binding protein 1
• Alternate names: insulin-like growth factor 2 mRNA-binding protein 1, IGF-II mRNA-binding protein 1, IGF2 mRNA-binding protein 1, VICKZ family member 1, ZBP-1, coding region determinant-binding protein, insulin-like growth factor 2 mRNA binding protein 1 deltaN CRDBP, zipcode-bi,
• Gene location: 17q21.32 (48997384: 49056144)     Exons: 16     NC_000017.11
• Gene summary(Entrez): This gene encodes a member of the insulin-like growth factor 2 mRNA-binding protein family. The protein encoded by this gene contains four K homology domains and two RNA recognition motifs. It functions by binding to the mRNAs of certain genes, including
• OMIM: 604437

Protein Summary

• Protein general information: Q9NZI8  
  • Name: Insulin like growth factor 2 mRNA binding protein 1 (IGF2 mRNA binding protein 1) (IMP 1) (IMP1) (Coding region determinant binding protein) (CRD BP) (IGF II mRNA binding protein 1) (VICKZ family member 1) (Zipcode binding protein 1) (ZBP 1)
  • Length: 577  
  • Mass: 63481
  • Tissue specificity: Mainly expressed in the embryo, including in fetal liver, fetal lung, fetal kidney, fetal thymus (at protein level). Also expressed follicles of ovary, as well as in gonocytes of testis, spermatogonia, semen, oocytes and placenta (at p
• Sequence:

  MNKLYIGNLNESVTPADLEKVFAEHKISYSGQFLVKSGYAFVDCPDEHWAMKAIETFSGKVELQGKRLEIEHSVP
  KKQRSRKIQIRNIPPQLRWEVLDSLLAQYGTVENCEQVNTESETAVVNVTYSNREQTRQAIMKLNGHQLENHALK
  VSYIPDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDIPLRLLVPTQYVGAIIGKEGATIRNITKQT
  QSKIDVHRKENAGAAEKAISVHSTPEGCSSACKMILEIMHKEAKDTKTADEVPLKILAHNNFVGRLIGKEGRNLK
  KVEQDTETKITISSLQDLTLYNPERTITVKGAIENCCRAEQEIMKKVREAYENDVAAMSLQSHLIPGLNLAAVGL
  FPASSSAVPPPPSSVTGAAPYSSFMQAPEQEMVQVFIPAQAVGAIIGKKGQHIKQLSRFASASIKIAPPETPDSK
  VRMVIITGPPEAQFKAQGRIYGKLKEENFFGPKEEVKLETHIRVPASAAGRVIGKGGKTVNELQNLTAAEVVVPR
  DQTPDENDQVIVKIIGHFYASQMAQRKIRDILAQVKQQHQKGQSNQAQARRK

• Structural information:
  • Protein Domains: (2..7-)
    (/note="RRM-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (81..15-)
    (/note="RRM-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (195..26-)
    (/note="KH-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00117-)
    (2-)
  • Interpro: IPR034837  IPR034842  IPR004087  IPR004088  IPR036612   IPR012677  IPR035979  IPR000504  
  • Prosite: PS50084 PS50102
  • CDD: cd12625 cd12628
  • PDB: 3KRM 6QEY
  • PDBsum: 3KRM 6QEY
  • DIP: 38139
  • STRING: ENSP00000290341
• Other Databases: GeneCards:  IGF2BP1  Malacards:  IGF2BP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003729	mRNA binding	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0003730	mRNA 3'-UTR binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0007399	nervous system development	IBA	biological process
GO:0010468	regulation of gene expression	IBA	biological process
GO:0003730	mRNA 3'-UTR binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0051028	mRNA transport	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0006417	regulation of translation	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043488	regulation of mRNA stability	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030425	dendrite	IEA	cellular component
GO:0006403	RNA localization	IEA	biological process
GO:0097150	neuronal stem cell population maintenance	IEA	biological process
GO:0022013	pallium cell proliferation in forebrain	IEA	biological process
GO:0003730	mRNA 3'-UTR binding	IEA	molecular function
GO:0045182	translation regulator activity	IDA	molecular function
GO:0048027	mRNA 5'-UTR binding	IDA	molecular function
GO:0017148	negative regulation of translation	IDA	biological process
GO:0042035	regulation of cytokine biosynthetic process	IC	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0030175	filopodium	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0030426	growth cone	IEA	cellular component
GO:0030027	lamellipodium	IEA	cellular component
GO:0043197	dendritic spine	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0070937	CRD-mediated mRNA stability complex	IDA	cellular component
GO:1990904	ribonucleoprotein complex	IDA	cellular component
GO:0010494	cytoplasmic stress granule	IDA	cellular component
GO:0003729	mRNA binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0003729	mRNA binding	IDA	molecular function
GO:0070934	CRD-mediated mRNA stabilization	IDA	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0010610	regulation of mRNA stability involved in response to stress	IMP	biological process
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05206	MicroRNAs in cancer

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray