• Gene id: 10637

Gene Summary

• Gene Symbol: LEFTY1   Gene   UCSC   Ensembl
• Aliases: LEFTB, LEFTYB
• Gene name: left-right determination factor 1
• Alternate names: left-right determination factor 1, left-right determination factor B, protein lefty-1, protein lefty-B,
• Gene location: 1q42.12 (225889145: 225886281)     Exons: 4     NC_000001.11
• Gene summary(Entrez): This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate
• OMIM: 603037

Protein Summary

• Protein general information: O75610  
  • Name: Left right determination factor 1 (Left right determination factor B) (Protein lefty 1) (Protein lefty B)
  • Length: 366  
  • Mass: 40880
• Sequence:

  MQPLWLCWALWVLPLASPGAALTGEQLLGSLLRQLQLKEVPTLDRADMEELVIPTHVRAQYVALLQRSHGDRSRG
  KRFSQSFREVAGRFLALEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSARARVTVEWL
  RVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQG
  APAGLGEPQLELHTLDLGDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAENWVLEPPGFLAYECVGTCRQP
  PEALAFKWPFLGPRQCIASETDSLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP

• Structural information:
  • Interpro: IPR029034  IPR003942  IPR001839  IPR001111  IPR015615   IPR017948  
  • Prosite: PS00250 PS51362
  • STRING: ENSP00000272134
• Other Databases: GeneCards:  LEFTY1  Malacards:  LEFTY1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0060395	SMAD protein signal transduction	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0005125	cytokine activity	IBA	molecular function
GO:0030509	BMP signaling pathway	IBA	biological process
GO:0010862	positive regulation of pathway-restricted SMAD protein phosphorylation	IBA	biological process
GO:0005160	transforming growth factor beta receptor binding	IEA	molecular function
GO:0008083	growth factor activity	IEA	molecular function
GO:0005125	cytokine activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0008083	growth factor activity	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0007179	transforming growth factor beta receptor signaling pathway	TAS	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	ISS	biological process
GO:0003007	heart morphogenesis	ISS	biological process
GO:0007368	determination of left/right symmetry	ISS	biological process
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04550	Signaling pathways regulating pluripotency of stem cells
hsa04350	TGF-beta signaling pathway

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)