• Gene id: 10636

Gene Summary

• Gene Symbol: RGS14   Gene   UCSC   Ensembl
• Gene name: regulator of G protein signaling 14
• Alternate names: regulator of G-protein signaling 14,
• Gene location: 5q35.3 (177357671: 177372600)     Exons: 15     NC_000005.10
• Gene summary(Entrez): This gene encodes a member of the regulator of G-protein signaling family. This protein contains one RGS domain, two Raf-like Ras-binding domains (RBDs), and one GoLoco domain. The protein attenuates the signaling activity of G-proteins by binding, throug
• OMIM: 604512

Protein Summary

• Protein general information: O43566  
  • Name: Regulator of G protein signaling 14 (RGS14)
  • Length: 566  
  • Mass: 61447
• Sequence:

  MPGKPKHLGVPNGRMVLAVSDGELSSTTGPQGQGEGRGSSLSIHSLPSGPSSPFPTEEQPVASWALSFERLLQDP
  LGLAYFTEFLKKEFSAENVTFWKACERFQQIPASDTQQLAQEARNIYQEFLSSQALSPVNIDRQAWLGEEVLAEP
  RPDMFRAQQLQIFNLMKFDSYARFVKSPLYRECLLAEAEGRPLREPGSSRLGSPDATRKKPKLKPGKSLPLGVEE
  LGQLPPVEGPGGRPLRKSFRRELGGTANAALRRESQGSLNSSASLDLGFLAFVSSKSESHRKSLGSTEGESESRP
  GKYCCVYLPDGTASLALARPGLTIRDMLAGICEKRGLSLPDIKVYLVGNEQALVLDQDCTVLADQEVRLENRITF
  ELELTALERVVRISAKPTKRLQEALQPILEKHGLSPLEVVLHRPGEKQPLDLGKLVSSVAAQRLVLDTLPGVKIS
  KARDKSPCRSQGCPPRTQDKATHPPPASPSSLVKVPSSATGKRQTCDIEGLVELLNRVQSSGAHDQRGLLRKEDL
  VLPEFLQLPAQGPSSEETPPQTKSAAQPIGGSLNSTTDSAL

• Structural information:
  • Protein Domains: (67..18-)
    (/note="RGS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00171-)
    (302..37-)
    (/note="RBD-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00262-)
    (375..44-)
    (/note="RBD-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00262-)
    (-)
  • Interpro: IPR003109  IPR003116  IPR016137  IPR030776  IPR037881   IPR036305  IPR024066  IPR029071  
  • Prosite: PS50877 PS50898 PS50132
  • CDD: cd08743
  • PDB: 2JNU 2OM2 2XNS 3ONW 3QI2
  • PDBsum: 2JNU 2OM2 2XNS 3ONW 3QI2
  • DIP: 41167
  • STRING: ENSP00000386229
• Other Databases: GeneCards:  RGS14  Malacards:  RGS14

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008017	microtubule binding	IDA	molecular function
GO:0005819	spindle	IDA	cellular component
GO:0005096	GTPase activator activity	IDA	molecular function
GO:0005092	GDP-dissociation inhibitor activity	IDA	molecular function
GO:0060291	long-term synaptic potentiation	ISS	biological process
GO:0051301	cell division	IMP	biological process
GO:0050769	positive regulation of neurogenesis	ISS	biological process
GO:0030425	dendrite	ISS	cellular component
GO:0030159	signaling receptor complex adaptor activity	ISS	molecular function
GO:0007616	long-term memory	ISS	biological process
GO:0007051	spindle organization	IMP	biological process
GO:0005813	centrosome	ISS	cellular component
GO:0005813	centrosome	ISS	cellular component
GO:0070373	negative regulation of ERK1 and ERK2 cascade	ISS	biological process
GO:0048008	platelet-derived growth factor receptor signaling pathway	ISS	biological process
GO:0043620	regulation of DNA-templated transcription in response to stress	ISS	biological process
GO:0043407	negative regulation of MAP kinase activity	ISS	biological process
GO:0043197	dendritic spine	ISS	cellular component
GO:0031914	negative regulation of synaptic plasticity	ISS	biological process
GO:0016604	nuclear body	ISS	cellular component
GO:0014069	postsynaptic density	ISS	cellular component
GO:0010070	zygote asymmetric cell division	ISS	biological process
GO:0008542	visual learning	ISS	biological process
GO:0007612	learning	ISS	biological process
GO:0007059	chromosome segregation	ISS	biological process
GO:0006979	response to oxidative stress	ISS	biological process
GO:0006913	nucleocytoplasmic transport	ISS	biological process
GO:0006913	nucleocytoplasmic transport	ISS	biological process
GO:0005886	plasma membrane	ISS	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0000922	spindle pole	ISS	cellular component
GO:0007051	spindle organization	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0008017	microtubule binding	IEA	molecular function
GO:0008277	regulation of G protein-coupled receptor signaling pathway	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0001965	G-protein alpha-subunit binding	IEA	molecular function
GO:0005092	GDP-dissociation inhibitor activity	IEA	molecular function
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0030695	GTPase regulator activity	IEA	molecular function
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0009968	negative regulation of signal transduction	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0051301	cell division	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005096	GTPase activator activity	TAS	molecular function
GO:0008277	regulation of G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0003924	GTPase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0060291	long-term synaptic potentiation	IEA	biological process
GO:0045744	negative regulation of G protein-coupled receptor signaling pathway	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0007616	long-term memory	IEA	biological process
GO:0007051	spindle organization	IEA	biological process
GO:0005813	centrosome	IEA	cellular component
GO:0000278	mitotic cell cycle	IEA	biological process
GO:0050769	positive regulation of neurogenesis	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0030159	signaling receptor complex adaptor activity	IEA	molecular function
GO:0008277	regulation of G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005813	centrosome	IEA	cellular component
GO:0050804	modulation of chemical synaptic transmission	IEA	biological process
GO:0043620	regulation of DNA-templated transcription in response to stress	IEA	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0043407	negative regulation of MAP kinase activity	IEA	biological process
GO:0043197	dendritic spine	IEA	cellular component
GO:0032794	GTPase activating protein binding	IEA	molecular function
GO:0031914	negative regulation of synaptic plasticity	IEA	biological process
GO:0016604	nuclear body	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0010070	zygote asymmetric cell division	IEA	biological process
GO:0007612	learning	IEA	biological process
GO:0007059	chromosome segregation	IEA	biological process
GO:0006913	nucleocytoplasmic transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0070373	negative regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0048008	platelet-derived growth factor receptor signaling pathway	IEA	biological process
GO:0019901	protein kinase binding	IEA	molecular function
GO:0008542	visual learning	IEA	biological process
GO:0006979	response to oxidative stress	IEA	biological process
GO:0006913	nucleocytoplasmic transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0005092	GDP-dissociation inhibitor activity	IEA	molecular function
GO:0001965	G-protein alpha-subunit binding	IEA	molecular function
GO:0000922	spindle pole	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0043197	dendritic spine	IEA	cellular component
GO:0000922	spindle pole	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0016605	PML body	IEA	cellular component
GO:0045744	negative regulation of G protein-coupled receptor signaling pathway	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04015	Rap1 signaling pathway

Diseases

Associated diseases	References
Nephrolithiasis	PMID:22396660
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq