• Gene id: 10635

Gene Summary

• Gene Symbol: RAD51AP1   Gene   UCSC   Ensembl
• Aliases: PIR51
• Gene name: RAD51 associated protein 1
• Alternate names: RAD51-associated protein 1, RAD51-interacting protein,
• Gene location: 12p13.32 (4538889: 4560046)     Exons: 10     NC_000012.12
• OMIM: 610507

Protein Summary

• Protein general information: Q96B01  
  • Name: RAD51 associated protein 1 (RAD51 interacting protein)
  • Length: 352  
  • Mass: 38457
  • Tissue specificity: Highly expressed in testis and thymus. Lower levels in colon and small intestine. Little or no expression in spleen, prostate, ovary and peripheral blood leukocytes. {ECO
• Sequence:

  MVRPVRHKKPVNYSQFDHSDSDDDFVSATVPLNKKSRTAPKELKQDKPKPNLNNLRKEEIPVQEKTPKKRLPEGT
  FSIPASAVPCTKMALDDKLYQRDLEVALALSVKELPTVTTNVQNSQDKSIEKHGSSKIETMNKSPHISNCSVASD
  YLDLDKITVEDDVGGVQGKRKAASKAAAQQRKILLEGSDGDSANDTEPDFAPGEDSEDDSDFCESEDNDEDFSMR
  KSKVKEIKKKEVKVKSPVEKKEKKSKSKCNALVTSVDSAPAAVKSESQSLPKKVSLSSDTTRKPLEIRSPSAESK
  KPKWVPPAASGGSRSSSSPLVVVSVKSPNQSLRLGLSRLARVKPLHPNATST

• Structural information:
  • Interpro: IPR026632  IPR031419  
  • DIP: 35257
  • STRING: ENSP00000228843
• Other Databases: GeneCards:  RAD51AP1  Malacards:  RAD51AP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003690	double-stranded DNA binding	IDA	molecular function
GO:0036297	interstrand cross-link repair	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0000790	nuclear chromatin	IDA	cellular component
GO:0000724	double-strand break repair via homologous recombination	IMP	biological process
GO:0036297	interstrand cross-link repair	IBA	biological process
GO:0003690	double-stranded DNA binding	IBA	molecular function
GO:0003697	single-stranded DNA binding	IBA	molecular function
GO:0000790	nuclear chromatin	IBA	cellular component
GO:0000724	double-strand break repair via homologous recombination	IBA	biological process
GO:0010569	regulation of double-strand break repair via homologous recombination	IDA	biological process
GO:0071479	cellular response to ionizing radiation	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003690	double-stranded DNA binding	IEA	molecular function
GO:0006281	DNA repair	IEA	biological process
GO:0003697	single-stranded DNA binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006281	DNA repair	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0006310	DNA recombination	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003697	single-stranded DNA binding	TAS	molecular function
GO:0003723	RNA binding	TAS	molecular function
GO:0003690	double-stranded DNA binding	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0006281	DNA repair	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IDA	molecular function
GO:0005634	nucleus	IC	cellular component
GO:0003697	single-stranded DNA binding	IDA	molecular function
GO:0003690	double-stranded DNA binding	IDA	molecular function
GO:0000724	double-strand break repair via homologous recombination	NAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0006281	DNA repair	NAS	biological process
GO:0032991	protein-containing complex	IMP	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R