• Gene id: 10632

Gene Summary

• Gene Symbol: ATP5MG   Gene   UCSC   Ensembl
• Aliases: ATP5JG, ATP5L
• Gene name: ATP synthase membrane subunit g
• Alternate names: ATP synthase subunit g, mitochondrial, ATP synthase g chain, mitochondrial, ATP synthase, H+ transporting, mitochondrial F0 complex, subunit G, ATP synthase, H+ transporting, mitochondrial F1F0, subunit g, ATP synthase, H+ transporting, mitochondrial Fo compl,
• Gene location: 11q23.3 (118401388: 118409846)     Exons: 2     NC_000011.10
• Gene summary(Entrez): Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the
• OMIM: 617473

Protein Summary

• Protein general information: O75964  
  • Name: ATP synthase subunit g, mitochondrial (ATPase subunit g) (ATP synthase membrane subunit g)
  • Length: 103  
  • Mass: 11428
• Sequence:

  MAQFVRNLVEKTPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPRAIQSLKKIVNSAQTGSFKQLTVKEAVL
  NGLVATEVLMWFYVGEIIGKRGIIGYDV

• Structural information:
  • Interpro: IPR006808  IPR016702  
  • STRING: ENSP00000300688
• Other Databases: GeneCards:  ATP5MG  Malacards:  ATP5MG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015986	ATP synthesis coupled proton transport	IBA	biological process
GO:0000276	mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)	IBA	cellular component
GO:0015986	ATP synthesis coupled proton transport	IEA	biological process
GO:0000276	mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)	IEA	cellular component
GO:0015078	proton transmembrane transporter activity	IEA	molecular function
GO:0006754	ATP biosynthetic process	IEA	biological process
GO:0045263	proton-transporting ATP synthase complex, coupling factor F(o)	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0042407	cristae formation	TAS	biological process
GO:0006754	ATP biosynthetic process	TAS	biological process
GO:0006754	ATP biosynthetic process	TAS	biological process
GO:0042776	mitochondrial ATP synthesis coupled proton transport	TAS	biological process
GO:0005739	mitochondrion	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0042776	mitochondrial ATP synthesis coupled proton transport	IDA	biological process
GO:0005753	mitochondrial proton-transporting ATP synthase complex	IDA	cellular component
GO:0046933	proton-transporting ATP synthase activity, rotational mechanism	IDA	contributes to

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04714	Thermogenesis
hsa00190	Oxidative phosphorylation

Diseases

Associated diseases	References
Alzheimer's disease	PMID:28474567
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881