• Gene id: 10631

Gene Summary

• Gene Symbol: POSTN   Gene   UCSC   Ensembl
• Aliases: OSF-2, OSF2, PDLPOSTN, PN
• Gene name: periostin
• Alternate names: periostin, osteoblast specific factor 2 (fasciclin I-like), periodontal ligament-specific periostin, periostin, osteoblast specific factor,
• Gene location: 13q13.3 (37598843: 37562581)     Exons: 25     NC_000013.11
• Gene summary(Entrez): This gene encodes a secreted extracellular matrix protein that functions in tissue development and regeneration, including wound healing, and ventricular remodeling following myocardial infarction. The encoded protein binds to integrins to support adhesio
• OMIM: 608777

Protein Summary

• Protein general information: Q15063  
  • Name: Periostin (PN) (Osteoblast specific factor 2) (OSF 2)
  • Length: 836  
  • Mass: 93314
  • Tissue specificity: Widely expressed with highest levels in aorta, stomach, lower gastrointestinal tract, placenta, uterus, thyroid tissue and breast. Up-regulated in epithelial ovarian tumors. Not expressed in normal ovaries. Also highly expressed at the
• Sequence:

  MIPFLPMFSLLLLLIVNPINANNHYDKILAHSRIRGRDQGPNVCALQQILGTKKKYFSTCKNWYKKSICGQKTTV
  LYECCPGYMRMEGMKGCPAVLPIDHVYGTLGIVGATTTQRYSDASKLREEIEGKGSFTYFAPSNEAWDNLDSDIR
  RGLESNVNVELLNALHSHMINKRMLTKDLKNGMIIPSMYNNLGLFINHYPNGVVTVNCARIIHGNQIATNGVVHV
  IDRVLTQIGTSIQDFIEAEDDLSSFRAAAITSDILEALGRDGHFTLFAPTNEAFEKLPRGVLERIMGDKVASEAL
  MKYHILNTLQCSESIMGGAVFETLEGNTIEIGCDGDSITVNGIKMVNKKDIVTNNGVIHLIDQVLIPDSAKQVIE
  LAGKQQTTFTDLVAQLGLASALRPDGEYTLLAPVNNAFSDDTLSMDQRLLKLILQNHILKVKVGLNELYNGQILE
  TIGGKQLRVFVYRTAVCIENSCMEKGSKQGRNGAIHIFREIIKPAEKSLHEKLKQDKRFSTFLSLLEAADLKELL
  TQPGDWTLFVPTNDAFKGMTSEEKEILIRDKNALQNIILYHLTPGVFIGKGFEPGVTNILKTTQGSKIFLKEVND
  TLLVNELKSKESDIMTTNGVIHVVDKLLYPADTPVGNDQLLEILNKLIKYIQIKFVRGSTFKEIPVTVYTTKIIT
  KVVEPKIKVIEGSLQPIIKTEGPTLTKVKIEGEPEFRLIKEGETITEVIHGEPIIKKYTKIIDGVPVEITEKETR
  EERIITGPEIKYTRISTGGGETEETLKKLLQEEVTKVTKFIEGGDGHLFEDEEIKRLLQGDTPVRKLQANKKVQG
  SRRRLREGRSQ

• Structural information:
  • Protein Domains: (40..9-)
    (/note="EMI-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00384-)
    (97..23-)
    (/note="FAS1-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00082,-ECO:0000305)
    (234..36-)
    (/note="FAS1-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU0-)
  • Interpro: IPR011489  IPR036378  IPR000782  IPR016666  
  • Prosite: PS51041 PS50213
  • PDB: 5WT7 5YJG 5YJH
  • PDBsum: 5WT7 5YJG 5YJH
  • STRING: ENSP00000369071
• Other Databases: GeneCards:  POSTN  Malacards:  POSTN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0031012	extracellular matrix	IBA	cellular component
GO:0007155	cell adhesion	IBA	biological process
GO:0030198	extracellular matrix organization	IBA	biological process
GO:0050839	cell adhesion molecule binding	IBA	molecular function
GO:0071307	cellular response to vitamin K	IDA	biological process
GO:0062023	collagen-containing extracellular matrix	IDA	cellular component
GO:0046872	metal ion binding	IDA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0008201	heparin binding	IEA	molecular function
GO:0071307	cellular response to vitamin K	IEA	biological process
GO:0062023	collagen-containing extracellular matrix	IEA	cellular component
GO:0031012	extracellular matrix	IEA	cellular component
GO:1990523	bone regeneration	IEA	biological process
GO:1900025	negative regulation of substrate adhesion-dependent cell spreading	IEA	biological process
GO:0071560	cellular response to transforming growth factor beta stimulus	IEA	biological process
GO:0071356	cellular response to tumor necrosis factor	IEA	biological process
GO:0044344	cellular response to fibroblast growth factor stimulus	IEA	biological process
GO:0042060	wound healing	IEA	biological process
GO:0032355	response to estradiol	IEA	biological process
GO:0014850	response to muscle activity	IEA	biological process
GO:0009612	response to mechanical stimulus	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0001953	negative regulation of cell-matrix adhesion	IEA	biological process
GO:0001666	response to hypoxia	IEA	biological process
GO:0030198	extracellular matrix organization	IEA	biological process
GO:0009888	tissue development	IEA	biological process
GO:0008593	regulation of Notch signaling pathway	IEA	biological process
GO:0008201	heparin binding	IEA	molecular function
GO:0007155	cell adhesion	IEA	biological process
GO:1990138	neuron projection extension	IEA	biological process
GO:1904209	positive regulation of chemokine (C-X-C motif) ligand 2 production	IEA	biological process
GO:0031594	neuromuscular junction	IEA	cellular component
GO:0014911	positive regulation of smooth muscle cell migration	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0003073	regulation of systemic arterial blood pressure	IEA	biological process
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005802	trans-Golgi network	IDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	colocalizes with
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0007155	cell adhesion	IDA	biological process
GO:0031012	extracellular matrix	ISS	cellular component
GO:0008201	heparin binding	ISS	molecular function

Diseases

Associated diseases	References
congestive heart failure	PMID:16414453
Abdominal aortic aneurysm	PMID:24260297
Chronic kidney disease	PMID:22167593
Degenerative disc disease	PMID:23453657
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray