• Gene id: 10630

Gene Summary

• Gene Symbol: PDPN   Gene   UCSC   Ensembl
• Aliases: AGGRUS, GP36, GP40, Gp38, HT1A-1, OTS8, PA2.26, T1A, T1A-2, T1A2, TI1A
• Gene name: podoplanin
• Alternate names: podoplanin, PA2.26 antigen, T1-alpha, glycoprotein 36, glycoprotein, 36-KD, hT1alpha-1, hT1alpha-2, lung type I cell membrane associated glycoprotein, lung type-I cell membrane-associated glycoprotein (T1A-2),
• Gene location: 1p36.21 (13583756: 13617956)     Exons: 9     NC_000001.11
• Gene summary(Entrez): This gene encodes a type-I integral membrane glycoprotein with diverse distribution in human tissues. The physiological function of this protein may be related to its mucin-type character. The homologous protein in other species has been described as a di

Protein Summary

• Protein general information: Q86YL7  
  • Name: Podoplanin (Aggrus) (Glycoprotein 36) (Gp36) (PA2.26 antigen) (T1 alpha) (T1A) [Cleaved into: 29kDa cytosolic podoplanin intracellular domain (PICD)]
  • Length: 162  
  • Mass: 16698
  • Tissue specificity: Highly expressed in placenta, lung, skeletal muscle and brain. Weakly expressed in brain, kidney and liver. In placenta, expressed on the apical plasma membrane of endothelium. In lung, expressed in alveolar epithelium. Up-regulated in
• Sequence:

  MWKVSALLFVLGSASLWVLAEGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSV
  TGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEKDGLSTVTLVGIIVGVLLAIGFIGAIIV
  VVMRKMSGRYSP

• Structural information:
  • PDB: 3WSR 4YO0 5XCV
  • PDBsum: 3WSR 4YO0 5XCV
  • DIP: 61333
  • STRING: ENSP00000294489
• Other Databases: GeneCards:  PDPN  Malacards:  PDPN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:2000392	regulation of lamellipodium morphogenesis	IBA	biological process
GO:1905863	invadopodium organization	IBA	biological process
GO:1904328	regulation of myofibroblast contraction	IBA	biological process
GO:1901731	positive regulation of platelet aggregation	IBA	biological process
GO:1900024	regulation of substrate adhesion-dependent cell spreading	IBA	biological process
GO:0098609	cell-cell adhesion	IBA	biological process
GO:0090091	positive regulation of extracellular matrix disassembly	IBA	biological process
GO:0071437	invadopodium	IBA	cellular component
GO:0070252	actin-mediated cell contraction	IBA	biological process
GO:0035239	tube morphogenesis	IBA	biological process
GO:0030335	positive regulation of cell migration	IBA	biological process
GO:0030175	filopodium	IBA	cellular component
GO:0016323	basolateral plasma membrane	IBA	cellular component
GO:0007266	Rho protein signal transduction	IBA	biological process
GO:0000902	cell morphogenesis	IBA	biological process
GO:0055093	response to hyperoxia	IBA	biological process
GO:0051087	chaperone binding	IBA	molecular function
GO:0030324	lung development	IBA	biological process
GO:0030027	lamellipodium	IBA	cellular component
GO:0019956	chemokine binding	IBA	molecular function
GO:0016324	apical plasma membrane	IBA	cellular component
GO:0010718	positive regulation of epithelial to mesenchymal transition	IBA	biological process
GO:0005102	signaling receptor binding	IBA	molecular function
GO:0016323	basolateral plasma membrane	IDA	cellular component
GO:1901731	positive regulation of platelet aggregation	IDA	biological process
GO:0042995	cell projection	IDA	cellular component
GO:0032587	ruffle membrane	IDA	cellular component
GO:0031527	filopodium membrane	IDA	cellular component
GO:1901731	positive regulation of platelet aggregation	IDA	biological process
GO:0031410	cytoplasmic vesicle	IDA	cellular component
GO:0090091	positive regulation of extracellular matrix disassembly	IDA	biological process
GO:1905863	invadopodium organization	IDA	biological process
GO:0071437	invadopodium	IDA	cellular component
GO:0045121	membrane raft	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0031528	microvillus membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0097197	tetraspanin-enriched microdomain	IDA	cellular component
GO:0061851	leading edge of lamellipodium	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005102	signaling receptor binding	IDA	molecular function
GO:0016020	membrane	IDA	cellular component
GO:0031258	lamellipodium membrane	IDA	cellular component
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0007266	Rho protein signal transduction	IMP	biological process
GO:0070252	actin-mediated cell contraction	ISS	biological process
GO:1901731	positive regulation of platelet aggregation	IMP	biological process
GO:0030168	platelet activation	TAS	biological process
GO:1904328	regulation of myofibroblast contraction	ISS	biological process
GO:1900024	regulation of substrate adhesion-dependent cell spreading	ISS	biological process
GO:0043066	negative regulation of apoptotic process	ISS	biological process
GO:0008285	negative regulation of cell population proliferation	ISS	biological process
GO:0060838	lymphatic endothelial cell fate commitment	ISS	biological process
GO:0044319	wound healing, spreading of cells	IMP	biological process
GO:2000392	regulation of lamellipodium morphogenesis	IMP	biological process
GO:1901731	positive regulation of platelet aggregation	IMP	biological process
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0051087	chaperone binding	IPI	molecular function
GO:0019956	chemokine binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0010718	positive regulation of epithelial to mesenchymal transition	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048535	lymph node development	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0010718	positive regulation of epithelial to mesenchymal transition	IMP	biological process
GO:0008360	regulation of cell shape	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030168	platelet activation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032587	ruffle membrane	IEA	cellular component
GO:0031527	filopodium membrane	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0031258	lamellipodium membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0031528	microvillus membrane	IEA	cellular component
GO:0071437	invadopodium	IEA	cellular component
GO:0045121	membrane raft	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0015884	folic acid transport	IEA	biological process
GO:0006833	water transport	IEA	biological process
GO:0003333	amino acid transmembrane transport	IEA	biological process
GO:0030027	lamellipodium	ISS	cellular component
GO:0015171	amino acid transmembrane transporter activity	ISS	NOT|molecular function
GO:0006833	water transport	ISS	NOT|biological process
GO:0005886	plasma membrane	ISS	cellular component
GO:0005372	water transmembrane transporter activity	ISS	NOT|molecular function
GO:0015250	water channel activity	ISS	NOT|molecular function
GO:0001726	ruffle	ISS	cellular component
GO:0030324	lung development	ISS	biological process
GO:0015884	folic acid transport	ISS	NOT|biological process
GO:0051272	positive regulation of cellular component movement	ISS	biological process
GO:0030175	filopodium	ISS	cellular component
GO:0008517	folic acid transmembrane transporter activity	ISS	NOT|molecular function
GO:0006865	amino acid transport	ISS	NOT|biological process
GO:0001946	lymphangiogenesis	ISS	biological process
GO:0000902	cell morphogenesis	ISS	biological process

Diseases

Associated diseases	References
Glioblastoma multiforme	PMID:16979138
Germinoma	PMID:16718353
Cervical squamous cell carcinoma	PMID:16528371
seminoma	PMID:17951198
renal cell carcinoma	PMID:18291512
in situ carcinoma	PMID:16736189
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq