• Gene id: 10629

Gene Summary

• Gene Symbol: TAF6L   Gene   UCSC   Ensembl
• Aliases: PAF65A
• Gene name: TATA-box binding protein associated factor 6 like
• Alternate names: TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L, PAF65-alpha, PCAF-associated factor 65-alpha, TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa, p300/CBP-associated factor (PCAF,
• Gene location: 11q12.3 (62771395: 62787341)     Exons: 11     NC_000011.10
• Gene summary(Entrez): Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly,
• OMIM: 602946

Protein Summary

• Protein general information: Q9Y6J9  
  • Name: TAF6 like RNA polymerase II p300/CBP associated factor associated factor 65 kDa subunit 6L (TAF6L) (PCAF associated factor 65 alpha) (PAF65 alpha)
  • Length: 622  
  • Mass: 67814
• Sequence:

  MSEREERRFVEIPRESVRLMAESTGLELSDEVAALLAEDVCYRLREATQNSSQFMKHTKRRKLTVEDFNRALRWS
  SVEAVCGYGSQEALPMRPAREGELYFPEDREVNLVELALATNIPKGCAETAVRVHVSYLDGKGNLAPQGSVPSAV
  SSLTDDLLKYYHQVTRAVLGDDPQLMKVALQDLQTNSKIGALLPYFVYVVSGVKSVSHDLEQLHRLLQVARSLFR
  NPHLCLGPYVRCLVGSVLYCVLEPLAASINPLNDHWTLRDGAALLLSHIFWTHGDLVSGLYQHILLSLQKILADP
  VRPLCCHYGAVVGLHALGWKAVERVLYPHLSTYWTNLQAVLDDYSVSNAQVKADGHKVYGAILVAVERLLKMKAQ
  AAEPNRGGPGGRGCRRLDDLPWDSLLFQESSSGGGAEPSFGSGLPLPPGGAGPEDPSLSVTLADIYRELYAFFGD
  SLATRFGTGQPAPTAPRPPGDKKEPAAAPDSVRKMPQLTASAIVSPHGDESPRGSGGGGPASASGPAASESRPLP
  RVHRARGAPRQQGPGTGTRDVFQKSRFAPRGAPHFRFIIAGRQAGRRCRGRLFQTAFPAPYGPSPASRYVQKLPM
  IGRTSRPARRWALSDYSLYLPL

• Structural information:
  • Interpro: IPR009072  IPR037796  IPR011442  IPR004823  
  • STRING: ENSP00000294168
• Other Databases: GeneCards:  TAF6L  Malacards:  TAF6L

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006325	chromatin organization	IBA	biological process
GO:0060261	positive regulation of transcription initiation from RNA polymerase II promoter	IBA	biological process
GO:0030914	STAGA complex	IBA	cellular component
GO:0016251	RNA polymerase II general transcription initiation factor activity	IBA	contributes to
GO:0005634	nucleus	IBA	cellular component
GO:0003713	transcription coactivator activity	IBA	molecular function
GO:0000124	SAGA complex	IBA	cellular component
GO:1904672	regulation of somatic stem cell population maintenance	ISS	biological process
GO:0006355	regulation of transcription, DNA-templated	ISS	biological process
GO:0005669	transcription factor TFIID complex	IEA	cellular component
GO:0006352	DNA-templated transcription, initiation	IEA	biological process
GO:0006367	transcription initiation from RNA polymerase II promoter	IEA	biological process
GO:0000124	SAGA complex	IEA	cellular component
GO:0016251	RNA polymerase II general transcription initiation factor activity	IEA	molecular function
GO:0046695	SLIK (SAGA-like) complex	IEA	cellular component
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	TAS	molecular function
GO:0006338	chromatin remodeling	TAS	biological process
GO:0000118	histone deacetylase complex	TAS	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0043966	histone H3 acetylation	IDA	biological process
GO:0030914	STAGA complex	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03022	Basal transcription factors

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881