• Gene id: 10628

Gene Summary

• Gene Symbol: TXNIP   Gene   UCSC   Ensembl
• Aliases: ARRDC6, EST01027, HHCPA78, THIF, VDUP1
• Gene name: thioredoxin interacting protein
• Alternate names: thioredoxin-interacting protein, thioredoxin binding protein 2, upregulated by 1,25-dihydroxyvitamin D-3, vitamin D3 up-regulated protein 1,
• Gene location: 1q21.1 (145996578: 145992434)     Exons: 7     NC_000001.11
• Gene summary(Entrez): This gene encodes a thioredoxin-binding protein that is a member of the alpha arrestin protein family. Thioredoxin is a thiol-oxidoreductase that is a major regulator of cellular redox signaling which protects cells from oxidative stress. This protein inh
• OMIM: 606599

Protein Summary

• Protein general information: Q9H3M7  
  • Name: Thioredoxin interacting protein (Thioredoxin binding protein 2) (Vitamin D3 up regulated protein 1)
  • Length: 391  
  • Mass: 43661
• Sequence:

  MVMFKKIKSFEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGSQQCKQTSEYLRYEDT
  LLLEDQPTGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGCVDYWVKAFLDRPSQPTQETKKNFEVVDLVD
  VNTPDLMAPVSAKKEKKVSCMFIPDGRVSVSARIDRKGFCEGDEISIHADFENTCSRIVVPKAAIVARHTYLANG
  QTKVLTQKLSSVRGNHIISGTCASWRGKSLRVQKIRPSILGCNILRVEYSLLIYVSVPGSKKVILDLPLVIGSRS
  GLSSRTSSMASRTSSEMSWVDLNIPDTPEAPPCYMDVIPEDHRLESPTTPLLDDMDGSQDSPIFMYAPEFKFMPP
  PTYTEVDPCILNNNVQ

• Structural information:
  • Interpro: IPR011021  IPR014752  IPR011022  IPR014756  
  • PDB: 4GEI 4GEJ 4GFX 4LL1 4LL4 4ROF 4ROJ 5CQ2 5DF6 5DWS 5DZD
  • PDBsum: 4GEI 4GEJ 4GFX 4LL1 4LL4 4ROF 4ROJ 5CQ2 5DF6 5DWS 5DZD
  • STRING: ENSP00000462521
• Other Databases: GeneCards:  TXNIP  Malacards:  TXNIP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0015031	protein transport	IBA	biological process
GO:0031625	ubiquitin protein ligase binding	IBA	molecular function
GO:0071228	cellular response to tumor cell	IDA	biological process
GO:0051782	negative regulation of cell division	IDA	biological process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051592	response to calcium ion	IEA	biological process
GO:0042127	regulation of cell population proliferation	IEA	biological process
GO:0032570	response to progesterone	IEA	biological process
GO:0032355	response to estradiol	IEA	biological process
GO:0009749	response to glucose	IEA	biological process
GO:0009612	response to mechanical stimulus	IEA	biological process
GO:0004857	enzyme inhibitor activity	IEA	molecular function
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0042542	response to hydrogen peroxide	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0005758	mitochondrial intermembrane space	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0048008	platelet-derived growth factor receptor signaling pathway	IEA	biological process
GO:0006979	response to oxidative stress	IEA	biological process
GO:0006606	protein import into nucleus	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0043086	negative regulation of catalytic activity	IEA	biological process
GO:0030216	keratinocyte differentiation	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04621	NOD-like receptor signaling pathway

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)