• Gene id: 10626

Gene Summary

• Gene Symbol: TRIM16   Gene   UCSC   Ensembl
• Aliases: EBBP
• Gene name: tripartite motif containing 16
• Alternate names: tripartite motif-containing protein 16, E3 ubiquitin-protein ligase TRIM16, estrogen-responsive B box protein,
• Gene location: 17p12 (15684310: 15627965)     Exons: 12     NC_000017.11
• Gene summary(Entrez): The protein encoded by this gene is a tripartite motif (TRIM) family member that contains two B box domains and a coiled-coiled region that are characteristic of the B box zinc finger protein family. While it lacks a RING domain found in other TRIM protei
• OMIM: 617817

Protein Summary

• Protein general information: O95361  
  • Name: Tripartite motif containing protein 16 (EC 2.3.2.27) (E3 ubiquitin protein ligase TRIM16) (Estrogen responsive B box protein)
  • Length: 564  
  • Mass: 63955
  • Tissue specificity: Highest levels found in testis, ovary, small intestine, colon, placenta, heart, skeletal muscle and mammary gland. More highly expressed in the fetus than in the corresponding adult tissues. Expressed in basal keratinocytes.
• Sequence:

  MAELDLMAPGPLPRATAQPPAPLSPDSGSPSPDSGSASPVEEEDVGSSEKLGRETEEQDSDSAEQGDPAGEGKEV
  LCDFCLDDTRRVKAVKSCLTCMVNYCEEHLQPHQVNIKLQSHLLTEPVKDHNWRYCPAHHSPLSAFCCPDQQCIC
  QDCCQEHSGHTIVSLDAARRDKEAELQCTQLDLERKLKLNENAISRLQANQKSVLVSVSEVKAVAEMQFGELLAA
  VRKAQANVMLFLEEKEQAALSQANGIKAHLEYRSAEMEKSKQELERMAAISNTVQFLEEYCKFKNTEDITFPSVY
  VGLKDKLSGIRKVITESTVHLIQLLENYKKKLQEFSKEEEYDIRTQVSAVVQRKYWTSKPEPSTREQFLQYAYDI
  TFDPDTAHKYLRLQEENRKVTNTTPWEHPYPDLPSRFLHWRQVLSQQSLYLHRYYFEVEIFGAGTYVGLTCKGID
  RKGEERNSCISGNNFSWSLQWNGKEFTAWYSDMETPLKAGPFRRLGVYIDFPGGILSFYGVEYDTMTLVHKFACK
  FSEPVYAAFWLSKKENAIRIVDLGEEPEKPAPSLVGTAP

• Structural information:
  • Protein Domains: (355..55-)
    (/note="B30.2/SPRY-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00548"-)
  • Interpro: IPR001870  IPR003879  IPR013320  IPR006574  IPR003877   IPR000315  
  • Prosite: PS50188 PS50119
  • STRING: ENSP00000463188
• Other Databases: GeneCards:  TRIM16  Malacards:  TRIM16

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008270	zinc ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0048386	positive regulation of retinoic acid receptor signaling pathway	IDA	biological process
GO:0016605	PML body	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0003677	DNA binding	IDA	molecular function
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045618	positive regulation of keratinocyte differentiation	IDA	biological process
GO:0060416	response to growth hormone	IDA	biological process
GO:0043967	histone H4 acetylation	IDA	biological process
GO:0043966	histone H3 acetylation	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0046683	response to organophosphorus	IEP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0019966	interleukin-1 binding	IPI	molecular function
GO:0050718	positive regulation of interleukin-1 beta secretion	IMP	biological process
GO:0032526	response to retinoic acid	IEP	biological process
GO:0032089	NACHT domain binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq