• Gene id: 10621

Gene Summary

• Gene Symbol: POLR3F   Gene   UCSC   Ensembl
• Aliases: C34, RPC39, RPC6
• Gene name: RNA polymerase III subunit F
• Alternate names: DNA-directed RNA polymerase III subunit RPC6, RNA polymerase III C39 subunit, RNA polymerase III subunit C6, polymerase (RNA) III (DNA directed) polypeptide F, 39 kDa, polymerase (RNA) III subunit F,
• Gene location: 20p11.23 (212285409: 212361852)     Exons: 14     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is one of more than a dozen subunits forming eukaryotic RNA polymerase III (RNA Pol III), which transcribes 5S ribosomal RNA and tRNA genes. This protein has been shown to bind both TFIIIB90 and TBP, two subunits of RNA po
• OMIM: 617455

Protein Summary

• Protein general information: Q9H1D9  
  • Name: DNA directed RNA polymerase III subunit RPC6 (RNA polymerase III subunit C6) (DNA directed RNA polymerase III subunit F) (RNA polymerase III 39 kDa subunit) (RPC39)
  • Length: 316  
  • Mass: 35684
• Sequence:

  MAEVKVKVQPPDADPVEIENRIIELCHQFPHGITDQVIQNEMPHIEAQQRAVAINRLLSMGQLDLLRSNTGLLYR
  IKDSQNAGKMKGSDNQEKLVYQIIEDAGNKGIWSRDIRYKSNLPLTEINKILKNLESKKLIKAVKSVAASKKKVY
  MLYNLQPDRSVTGGAWYSDQDFESEFVEVLNQQCFKFLQSKAETARESKQNPMIQRNSSFASSHEVWKYICELGI
  SKVELSMEDIETILNTLIYDGKVEMTIIAAKEGTVGSVDGHMKLYRAVNPIIPPTGLVRAPCGLCPVFDDCHEGG
  EISPSNCIYMTEWLEF

• Structural information:
  • Interpro: IPR007832  IPR016049  IPR036388  IPR036390  
  • PDB: 2DK5 2YU3
  • PDBsum: 2DK5 2YU3
  • DIP: 34646
  • STRING: ENSP00000366828
• Other Databases: GeneCards:  POLR3F  Malacards:  POLR3F

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005666	RNA polymerase III complex	IBA	cellular component
GO:0003690	double-stranded DNA binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045089	positive regulation of innate immune response	IMP	biological process
GO:0032728	positive regulation of interferon-beta production	IMP	biological process
GO:0006383	transcription by RNA polymerase III	IEA	biological process
GO:0005666	RNA polymerase III complex	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0003899	DNA-directed 5'-3' RNA polymerase activity	IEA	molecular function
GO:0005666	RNA polymerase III complex	IDA	cellular component
GO:0032481	positive regulation of type I interferon production	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006359	regulation of transcription by RNA polymerase III	NAS	biological process
GO:0003899	DNA-directed 5'-3' RNA polymerase activity	NAS	molecular function
GO:0005666	RNA polymerase III complex	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04623	Cytosolic DNA-sensing pathway
hsa03020	RNA polymerase

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881