• Gene id: 10617

Gene Summary

• Gene Symbol: STAMBP   Gene   UCSC   Ensembl
• Aliases: AMSH, MICCAP
• Gene name: STAM binding protein
• Alternate names: STAM-binding protein, associated molecule with the SH3 domain of STAM, endosome-associated ubiquitin isopeptidase, testicular secretory protein Li 54,
• Gene location: 2p13.1 (73828910: 73873655)     Exons: 15     NC_000002.12
• Gene summary(Entrez): Cytokine-mediated signal transduction in the JAK-STAT cascade requires the involvement of adaptor molecules. One such signal-transducing adaptor molecule contains an SH3 domain that is required for induction of MYC and cell growth. The protein encoded by
• OMIM: 300286

Protein Summary

• Protein general information: O95630  
  • Name: STAM binding protein (EC 3.4.19. ) (Associated molecule with the SH3 domain of STAM) (Endosome associated ubiquitin isopeptidase)
  • Length: 424  
  • Mass: 48077
  • Tissue specificity: Ubiquitously expressed.
• Sequence:

  MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLFIEKLP
  KHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQELEKEKQRVA
  QQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPTLTVSSIQPSDCHTTV
  RPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVETCGILCGKLMRNEFTITHVL
  IPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESVAIVCSPKFQETG
  FFKLTDHGLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRAVTITDLR

• Structural information:
  • Protein Domains: (257..38-)
    (/note="MPN-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01182"-)
  • Interpro: IPR000555  IPR037518  IPR015063  
  • Prosite: PS50249
  • PDB: 2XZE 3RZU 3RZV 5IXF
  • PDBsum: 2XZE 3RZU 3RZV 5IXF
  • DIP: 33062
  • STRING: ENSP00000377633
• Other Databases: GeneCards:  STAMBP  Malacards:  STAMBP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016020	membrane	IBA	cellular component
GO:0016579	protein deubiquitination	IBA	biological process
GO:0032154	cleavage furrow	IBA	cellular component
GO:0061578	Lys63-specific deubiquitinase activity	IBA	molecular function
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IBA	molecular function
GO:0005768	endosome	IBA	cellular component
GO:0070536	protein K63-linked deubiquitination	IBA	biological process
GO:0046580	negative regulation of Ras protein signal transduction	IMP	biological process
GO:0014067	negative regulation of phosphatidylinositol 3-kinase signaling	IMP	biological process
GO:0005768	endosome	IEA	cellular component
GO:0008233	peptidase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0007259	receptor signaling pathway via JAK-STAT	TAS	biological process
GO:0008284	positive regulation of cell population proliferation	TAS	biological process
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IDA	molecular function
GO:0032154	cleavage furrow	IDA	cellular component
GO:0016579	protein deubiquitination	IMP	biological process
GO:0000281	mitotic cytokinesis	IMP	biological process
GO:0016579	protein deubiquitination	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043524	negative regulation of neuron apoptotic process	IEA	biological process
GO:0032154	cleavage furrow	IEA	cellular component
GO:0016579	protein deubiquitination	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0019904	protein domain specific binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis

Diseases

Associated diseases	References
Microcephaly-capillary malformation syndrome	KEGG:H01872
Microcephaly-capillary malformation syndrome	KEGG:H01872
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881