• Gene id: 10605

Gene Summary

• Gene Symbol: PAIP1   Gene   UCSC   Ensembl
• Gene name: poly(A) binding protein interacting protein 1
• Alternate names: polyadenylate-binding protein-interacting protein 1, PABC1-interacting protein 1, PABP-interacting protein 1, PAIP-1,
• Gene location: 5p12 (43557418: 43526266)     Exons: 13     NC_000005.10
• Gene summary(Entrez): The protein encoded by this gene interacts with poly(A)-binding protein and with the cap-binding complex eIF4A. It is involved in translational initiation and protein biosynthesis. Overexpression of this gene in COS7 cells stimulates translation. Alternat
• OMIM: 605184

Protein Summary

• Protein general information: Q9H074  
  • Name: Polyadenylate binding protein interacting protein 1 (PABP interacting protein 1) (PAIP 1) (Poly(A) binding protein interacting protein 1)
  • Length: 479  
  • Mass: 53525
• Sequence:

  MSDGFDRAPGAGRGRSRGLGRGGGGPEGGGFPNGAGPAERARHQPPQPKAPGFLQPPPLRQPRTTPPPGAQCEVP
  ASPQRPSRPGALPEQTRPLRAPPSSQDKIPQQNSESAMAKPQVVVAPVLMSKLSVNAPEFYPSGYSSSYTESYED
  GCEDYPTLSEYVQDFLNHLTEQPGSFETEIEQFAETLNGCVTTDDALQELVELIYQQATSIPNFSYMGARLCNYL
  SHHLTISPQSGNFRQLLLQRCRTEYEVKDQAAKGDEVTRKRFHAFVLFLGELYLNLEIKGTNGQVTRADILQVGL
  RELLNALFSNPMDDNLICAVKLLKLTGSVLEDAWKEKGKMDMEEIIQRIENVVLDANCSRDVKQMLLKLVELRSS
  NWGRVHATSTYREATPENDPNYFMNEPTFYTSDGVPFTAADPDYQEKYQELLEREDFFPDYEENGTDLSGAGDPY
  LDDIDDEMDPEIEEAYEKFCLESERKRKQ

• Structural information:
  • Protein Domains: (159..37-)
    (/note="MIF4G"-)
  • Interpro: IPR016024  IPR009818  IPR016021  IPR003890  
  • PDB: 1JH4 3NTW 3RK6
  • PDBsum: 1JH4 3NTW 3RK6
  • STRING: ENSP00000302768
• Other Databases: GeneCards:  PAIP1  Malacards:  PAIP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008494	translation activator activity	IBA	molecular function
GO:0006446	regulation of translational initiation	IBA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0006417	regulation of translation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	TAS	molecular function
GO:0005737	cytoplasm	TAS	cellular component
GO:0006413	translational initiation	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0045727	positive regulation of translation	IEA	biological process
GO:0045727	positive regulation of translation	IEA	biological process
GO:0008494	translation activator activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048255	mRNA stabilization	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03013	RNA transport

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)