• Gene id: 10600

Gene Summary

• Gene Symbol: USP16   Gene   UCSC   Ensembl
• Aliases: UBP-M, UBPM
• Gene name: ubiquitin specific peptidase 16
• Alternate names: ubiquitin carboxyl-terminal hydrolase 16, deubiquitinating enzyme 16, ubiquitin specific protease 16, ubiquitin thioesterase 16, ubiquitin thiolesterase 16, ubiquitin-processing protease UBP-M, ubiquitin-specific processing protease 16,
• Gene location: 21q21.3 (29024616: 29054487)     Exons: 20     NC_000021.9
• Gene summary(Entrez): This gene encodes a deubiquitinating enzyme that is phosphorylated at the onset of mitosis and then dephosphorylated at the metaphase/anaphase transition. It can deubiquitinate H2A, one of two major ubiquitinated proteins of chromatin, in vitro and a muta
• OMIM: 604735

Protein Summary

• Protein general information: Q9Y5T5  
  • Name: Ubiquitin carboxyl terminal hydrolase 16 (EC 3.4.19.12) (Deubiquitinating enzyme 16) (Ubiquitin thioesterase 16) (Ubiquitin processing protease UBP M) (Ubiquitin specific processing protease 16)
  • Length: 823  
  • Mass: 93570
  • Tissue specificity: Present in all the tissues examined including fetal brain, lung, liver, kidney, and adult heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. {ECO
• Sequence:

  MGKKRTKGKTVPIDDSSETLEPVCRHIRKGLEQGNLKKALVNVEWNICQDCKTDNKVKDKAEEETEEKPSVWLCL
  KCGHQGCGRNSQEQHALKHYLTPRSEPHCLVLSLDNWSVWCYVCDNEVQYCSSNQLGQVVDYVRKQASITTPKPA
  EKDNGNIELENKKLEKESKNEQEREKKENMAKENPPMNSPCQITVKGLSNLGNTCFFNAVMQNLSQTPVLRELLK
  EVKMSGTIVKIEPPDLALTEPLEINLEPPGPLTLAMSQFLNEMQETKKGVVTPKELFSQVCKKAVRFKGYQQQDS
  QELLRYLLDGMRAEEHQRVSKGILKAFGNSTEKLDEELKNKVKDYEKKKSMPSFVDRIFGGELTSMIMCDQCRTV
  SLVHESFLDLSLPVLDDQSGKKSVNDKNLKKTVEDEDQDSEEEKDNDSYIKERSDIPSGTSKHLQKKAKKQAKKQ
  AKNQRRQQKIQGKVLHLNDICTIDHPEDSEYEAEMSLQGEVNIKSNHISQEGVMHKEYCVNQKDLNGQAKMIESV
  TDNQKSTEEVDMKNINMDNDLEVLTSSPTRNLNGAYLTEGSNGEVDISNGFKNLNLNAALHPDEINIEILNDSHT
  PGTKVYEVVNEDPETAFCTLANREVFNTDECSIQHCLYQFTRNEKLRDANKLLCEVCTRRQCNGPKANIKGERKH
  VYTNAKKQMLISLAPPVLTLHLKRFQQAGFNLRKVNKHIKFPEILDLAPFCTLKCKNVAEENTRVLYSLYGVVEH
  SGTMRSGHYTAYAKARTANSHLSNLVLHGDIPQDFEMESKGQWFHISDTHVQAVPTTKVLNSQAYLLFYERIL

• Structural information:
  • Protein Domains: (196..82-)
    (/note="USP"-)
  • Interpro: IPR038765  IPR001394  IPR030849  IPR018200  IPR028889   IPR013083  IPR001607  
  • Prosite: PS00972 PS00973 PS50235 PS50271
  • PDB: 2I50
  • PDBsum: 2I50
  • DIP: 53761
  • STRING: ENSP00000334808
• Other Databases: GeneCards:  USP16  Malacards:  USP16

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016578	histone deubiquitination	IDA	biological process
GO:0000278	mitotic cell cycle	IDA	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0051289	protein homotetramerization	IPI	biological process
GO:0045901	positive regulation of translational elongation	IMP	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IMP	biological process
GO:0035522	monoubiquitinated histone H2A deubiquitination	ISS	biological process
GO:0006357	regulation of transcription by RNA polymerase II	ISS	biological process
GO:0070537	histone H2A K63-linked deubiquitination	IMP	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	ISS	biological process
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IEA	molecular function
GO:0006511	ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0016578	histone deubiquitination	IEA	biological process
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0010468	regulation of gene expression	IEA	biological process
GO:0016579	protein deubiquitination	IEA	biological process
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0006325	chromatin organization	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004843	thiol-dependent ubiquitin-specific protease activity	TAS	molecular function
GO:0005737	cytoplasm	TAS	cellular component
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	IEA	molecular function
GO:0016579	protein deubiquitination	TAS	biological process
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	TAS	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0035522	monoubiquitinated histone H2A deubiquitination	IEA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016578	histone deubiquitination	IEA	biological process
GO:0051289	protein homotetramerization	IEA	biological process
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IEA	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0042393	histone binding	IEA	molecular function
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0000278	mitotic cell cycle	IEA	biological process
GO:0140014	mitotic nuclear division	IEA	biological process
GO:0003713	transcription coactivator activity	IEA	molecular function
GO:0043130	ubiquitin binding	IEA	molecular function
GO:0004197	cysteine-type endopeptidase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	IEA	molecular function
GO:0042393	histone binding	IDA	molecular function
GO:0008270	zinc ion binding	IDA	molecular function
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IDA	molecular function
GO:0043130	ubiquitin binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	IDA	molecular function
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0004197	cysteine-type endopeptidase activity	IMP	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881