• Gene id: 1060

Gene Summary

• Gene Symbol: CENPC   Gene   UCSC   Ensembl
• Aliases: CENP-C, CENPC1, MIF2, hcp-4
• Gene name: centromere protein C
• Alternate names: centromere protein C, CENP-C 1, centromere autoantigen C, centromere autoantigen C1, centromere protein C 1, interphase centromere complex protein 7,
• Gene location: 4q13.2 (67545502: 67468761)     Exons: 20     NC_000004.12
• Gene summary(Entrez): Centromere protein C 1 is a centromere autoantigen and a component of the inner kinetochore plate. The protein is required for maintaining proper kinetochore size and a timely transition to anaphase. A putative pseudogene exists on chromosome 12. [provide

Protein Summary

• Protein general information: Q03188  
  • Name: Centromere protein C (CENP C) (Centromere autoantigen C) (Centromere protein C 1) (CENP C 1) (Interphase centromere complex protein 7)
  • Length: 943  
  • Mass: 106834
• Sequence:

  MAASGLDHLKNGYRRRFCRPSRARDINTEQGQNVLEILQDCFEEKSLANDFSTNSTKSVPNSTRKIKDTCIQSPS
  KECQKSHPKSVPVSSKKKEASLQFVVEPSEATNRSVQAHEVHQKILATDVSSKNTPDSKKISSRNINDHHSEADE
  EFYLSVGSPSVLLDAKTSVSQNVIPSSAQKRETYTFENSVNMLPSSTEVSVKTKKRLNFDDKVMLKKIEIDNKVS
  DEEDKTSEGQERKPSGSSQNRIRDSEYEIQRQAKKSFSTLFLETVKRKSESSPIVRHAATAPPHSCPPDDTKLIE
  DEFIIDESDQSFASRSWITIPRKAGSLKQRTISPAESTALLQGRKSREKHHNILPKTLANDKHSHKPHPVETSQP
  SDKTVLDTSYALIGETVNNYRSTKYEMYSKNAEKPSRSKRTIKQKQRRKFMAKPAEEQLDVGQSKDENIHTSHIT
  QDEFQRNSDRNMEEHEEMGNDCVSKKQMPPVGSKKSSTRKDKEESKKKRFSSESKNKLVPEEVTSTVTKSRRISR
  RPSDWWVVKSEESPVYSNSSVRNELPMHHNSSRKSTKKTNQSSKNIRKKTIPLKRQKTATKGNQRVQKFLNAEGS
  GGIVGHDEISRCSLSEPLESDEADLAKKKNLDCSRSTRSSKNEDNIMTAQNVPLKPQTSGYTCNIPTESNLDSGE
  HKTSVLEESGPSRLNNNYLMSGKNDVDDEEVHGSSDDSKQSKVIPKNRIHHKLVLPSNTPNVRRTKRTRLKPLEY
  WRGERIDYQGRPSGGFVISGVLSPDTISSKRKAKENIGKVNKKSNKKRICLDNDERKTNLMVNLGIPLGDPLQPT
  RVKDPETREIILMDLVRPQDTYQFFVKHGELKVYKTLDTPFFSTGKLILGPQEEKGKQHVGQDILVFYVNFGDLL
  CTLHETPYILSTGDSFYVPSGNYYNIKNLRNEESVLLFTQIKR

• Structural information:
  • Interpro: IPR028386  IPR028931  IPR028052  IPR025974  IPR014710   IPR011051  
  • PDB: 5LSJ 5LSK 6MUO 6MUP 6SE6 6SEE 6SEF
  • PDBsum: 5LSJ 5LSK 6MUO 6MUP 6SE6 6SEE 6SEF
  • STRING: ENSP00000273853
• Other Databases: GeneCards:  CENPC  Malacards:  CENPC

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051455	monopolar spindle attachment to meiosis I kinetochore	IBA	biological process
GO:0019237	centromeric DNA binding	IBA	molecular function
GO:0051382	kinetochore assembly	IBA	biological process
GO:0051315	attachment of mitotic spindle microtubules to kinetochore	IBA	biological process
GO:0000778	condensed nuclear chromosome kinetochore	IBA	cellular component
GO:0005721	pericentric heterochromatin	IDA	cellular component
GO:0000776	kinetochore	IDA	cellular component
GO:0000278	mitotic cell cycle	IMP	biological process
GO:0051382	kinetochore assembly	IMP	biological process
GO:0007059	chromosome segregation	IMP	biological process
GO:0000776	kinetochore	IEA	cellular component
GO:0019237	centromeric DNA binding	IEA	molecular function
GO:0051382	kinetochore assembly	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0000776	kinetochore	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0003677	DNA binding	TAS	molecular function
GO:0000776	kinetochore	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0034080	CENP-A containing nucleosome assembly	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000780	condensed nuclear chromosome, centromeric region	IEA	cellular component
GO:0031618	nuclear pericentric heterochromatin	IEA	cellular component
GO:0000780	condensed nuclear chromosome, centromeric region	IDA	cellular component
GO:0000777	condensed chromosome kinetochore	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0030496	midbody	IDA	cellular component
GO:0051455	monopolar spindle attachment to meiosis I kinetochore	IBA	biological process
GO:0019237	centromeric DNA binding	IBA	molecular function
GO:0051382	kinetochore assembly	IBA	biological process
GO:0051315	attachment of mitotic spindle microtubules to kinetochore	IBA	biological process
GO:0000778	condensed nuclear chromosome kinetochore	IBA	cellular component
GO:0005721	pericentric heterochromatin	IDA	cellular component
GO:0000776	kinetochore	IDA	cellular component
GO:0000278	mitotic cell cycle	IMP	biological process
GO:0051382	kinetochore assembly	IMP	biological process
GO:0007059	chromosome segregation	IMP	biological process
GO:0000776	kinetochore	IEA	cellular component
GO:0019237	centromeric DNA binding	IEA	molecular function
GO:0051382	kinetochore assembly	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0000776	kinetochore	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0003677	DNA binding	TAS	molecular function
GO:0000776	kinetochore	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0034080	CENP-A containing nucleosome assembly	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000780	condensed nuclear chromosome, centromeric region	IEA	cellular component
GO:0031618	nuclear pericentric heterochromatin	IEA	cellular component
GO:0000780	condensed nuclear chromosome, centromeric region	IDA	cellular component
GO:0000777	condensed chromosome kinetochore	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0030496	midbody	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881