• Gene id: 10598

Gene Summary

• Gene Symbol: AHSA1   Gene   UCSC   Ensembl
• Aliases: AHA1, C14orf3, hAha1, p38
• Gene name: activator of HSP90 ATPase activity 1
• Alternate names: activator of 90 kDa heat shock protein ATPase homolog 1, AHA1, activator of heat shock 90kDa protein ATPase homolog 1,
• Gene location: 14q24.3 (77457866: 77469471)     Exons: 23     NC_000014.9
• OMIM: 608466

Protein Summary

• Protein general information: O95433  
  • Name: Activator of 90 kDa heat shock protein ATPase homolog 1 (AHA1) (p38)
  • Length: 338  
  • Mass: 38274
  • Tissue specificity: Expressed in numerous tissues, including brain, heart, skeletal muscle and kidney and, at lower levels, liver and placenta. {ECO
• Sequence:

  MAKWGEGDPRWIVEERADATNVNNWHWTERDASNWSTDKLKTLFLAVQVQNEEGKCEVTEVSKLDGEASINNRKG
  KLIFFYEWSVKLNWTGTSKSGVQYKGHVEIPNLSDENSVDEVEISVSLAKDEPDTNLVALMKEEGVKLLREAMGI
  YISTLKTEFTQGMILPTMNGESVDPVGQPALKTEERKAKPAPSKTQARPVGVKIPTCKITLKETFLTSPEELYRV
  FTTQELVQAFTHAPATLEADRGGKFHMVDGNVSGEFTDLVPEKHIVMKWRFKSWPEGHFATITLTFIDKNGETEL
  CMEGRGIPAPEEERTRQGWQRYYFEGIKQTFGYGARLF

• Structural information:
  • Interpro: IPR013538  IPR036338  IPR039981  IPR015310  IPR023393  
  • PDB: 1X53
  • PDBsum: 1X53
  • STRING: ENSP00000216479
• Other Databases: GeneCards:  AHSA1  Malacards:  AHSA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006457	protein folding	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0032781	positive regulation of ATPase activity	IBA	biological process
GO:0001671	ATPase activator activity	IBA	molecular function
GO:0001671	ATPase activator activity	IDA	molecular function
GO:0051087	chaperone binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001671	ATPase activator activity	IEA	molecular function
GO:0051087	chaperone binding	IEA	molecular function
GO:0051879	Hsp90 protein binding	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0051087	chaperone binding	IDA	molecular function
GO:0001671	ATPase activator activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051879	Hsp90 protein binding	IEA	molecular function
GO:0045296	cadherin binding	HDA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0001671	ATPase activator activity	IDA	molecular function
GO:0032781	positive regulation of ATPase activity	IDA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051879	Hsp90 protein binding	IPI	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)