• Gene id: 1059

Gene Summary

• Gene Symbol: CENPB   Gene   UCSC   Ensembl
• Gene name: centromere protein B
• Alternate names: major centromere autoantigen B, CENP-B, centromere autoantigen B, centromere protein B, 80kDa,
• Gene location: 20p13 (3786739: 3783850)     Exons: 1     NC_000020.11
• Gene summary(Entrez): This gene product is a highly conserved protein that facilitates centromere formation. It is a DNA-binding protein that is derived from transposases of the pogo DNA transposon family. It contains a helix-loop-helix DNA binding motif at the N-terminus, and
• OMIM: 607546

Protein Summary

• Protein general information: P07199  
  • Name: Major centromere autoantigen B (Centromere protein B) (CENP B)
  • Length: 599  
  • Mass: 65171
• Sequence:

  MGPKRRQLTFREKSRIIQEVEENPDLRKGEIARRFNIPPSTLSTILKNKRAILASERKYGVASTCRKTNKLSPYD
  KLEGLLIAWFQQIRAAGLPVKGIILKEKALRIAEELGMDDFTASNGWLDRFRRRHGVVSCSGVARARARNAAPRT
  PAAPASPAAVPSEGSGGSTTGWRAREEQPPSVAEGYASQDVFSATETSLWYDFLPDQAAGLCGGDGRPRQATQRL
  SVLLCANADGSEKLPPLVAGKSAKPRAGQAGLPCDYTANSKGGVTTQALAKYLKALDTRMAAESRRVLLLAGRLA
  AQSLDTSGLRHVQLAFFPPGTVHPLERGVVQQVKGHYRQAMLLKAMAALEGQDPSGLQLGLTEALHFVAAAWQAV
  EPSDIAACFREAGFGGGPNATITTSLKSEGEEEEEEEEEEEEEEGEGEEEEEEGEEEEEEGGEGEELGEEEEVEE
  EGDVDSDEEEEEDEESSSEGLEAEDWAQGVVEAGGSFGAYGAQEEAQCPTLHFLEGGEDSDSDSEEEDDEEEDDE
  DEDDDDDEEDGDEVPVPSFGEAMAYFAMVKRYLTSFPIDDRVQSHILHLEHDLVHVTRKNHARQAGVRGLGHQS

• Structural information:
  • Protein Domains: (2..5-)
    (/note="HTH-psq-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00320-)
    (65..13-)
    (/note="HTH-CENPB-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00583"-)
  • Interpro: IPR033062  IPR015115  IPR004875  IPR034882  IPR009057   IPR006600  IPR007889  
  • Prosite: PS51253 PS50960
  • PDB: 1BW6 1HLV 1UFI
  • PDBsum: 1BW6 1HLV 1UFI
  • STRING: ENSP00000369075
• Other Databases: GeneCards:  CENPB  Malacards:  CENPB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0003677	DNA binding	IBA	molecular function
GO:0003682	chromatin binding	IEA	molecular function
GO:0003696	satellite DNA binding	IEA	molecular function
GO:0042025	host cell nucleus	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0000775	chromosome, centromeric region	IDA	cellular component
GO:0031618	nuclear pericentric heterochromatin	IEA	cellular component
GO:0000780	condensed nuclear chromosome, centromeric region	IEA	cellular component
GO:0019237	centromeric DNA binding	IC	molecular function
GO:0043565	sequence-specific DNA binding	TAS	molecular function
GO:0000775	chromosome, centromeric region	IDA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0000775	chromosome, centromeric region	IDA	cellular component
GO:0005694	chromosome	IDA	cellular component
GO:0003682	chromatin binding	NAS	molecular function
GO:0003696	satellite DNA binding	NAS	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0003677	DNA binding	IBA	molecular function
GO:0003682	chromatin binding	IEA	molecular function
GO:0003696	satellite DNA binding	IEA	molecular function
GO:0042025	host cell nucleus	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0000775	chromosome, centromeric region	IDA	cellular component
GO:0031618	nuclear pericentric heterochromatin	IEA	cellular component
GO:0000780	condensed nuclear chromosome, centromeric region	IEA	cellular component
GO:0019237	centromeric DNA binding	IC	molecular function
GO:0043565	sequence-specific DNA binding	TAS	molecular function
GO:0000775	chromosome, centromeric region	IDA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0000775	chromosome, centromeric region	IDA	cellular component
GO:0005694	chromosome	IDA	cellular component
GO:0003682	chromatin binding	NAS	molecular function
GO:0003696	satellite DNA binding	NAS	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq