• Gene id: 10589

Gene Summary

• Gene Symbol: DRAP1   Gene   UCSC   Ensembl
• Aliases: NC2-alpha
• Gene name: DR1 associated protein 1
• Alternate names: dr1-associated corepressor, negative co-factor 2-alpha, negative cofactor 2 alpha,
• Gene location: 11q13.1 (65919425: 65921562)     Exons: 7     NC_000011.10
• Gene summary(Entrez): Transcriptional repression is a general mechanism for regulating transcriptional initiation in organisms ranging from yeast to humans. Accurate initiation of transcription from eukaryotic protein-encoding genes requires the assembly of a large multiprote
• OMIM: 300223

Protein Summary

• Protein general information: Q14919  
  • Name: Dr1 associated corepressor (Dr1 associated protein 1) (Negative cofactor 2 alpha) (NC2 alpha)
  • Length: 205  
  • Mass: 22350
  • Tissue specificity: Ubiquitous. Highly expressed in adult testis, heart, skeletal muscle, pancreas and brain, and in fetal brain, liver and kidney. {ECO
• Sequence:

  MPSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQCIE
  LEQQFDFLKDLVASVPDMQGDGEDNHMDGDKGARRGRKPGSGGRKNGGMGTKSKDKKLSGTDSEQEDESEDTDTD
  GEEETSQPPPQASHPSAHFQSPPTPFLPFASTLPLPPAPPGPSAPDEEDEEDYDS

• Structural information:
  • Protein Domains: (14..7-)
    (/note="Histone-fold"-)
  • Interpro: IPR003958  IPR009072  
  • PDB: 1JFI
  • PDBsum: 1JFI
  • STRING: ENSP00000307850
• Other Databases: GeneCards:  DRAP1  Malacards:  DRAP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003677	DNA binding	IDA	contributes to
GO:0090575	RNA polymerase II transcription regulator complex	IDA	cellular component
GO:0001091	RNA polymerase II general transcription initiation factor binding	IDA	molecular function
GO:0016251	RNA polymerase II general transcription initiation factor activity	IDA	molecular function
GO:0001091	RNA polymerase II general transcription initiation factor binding	IPI	molecular function
GO:0017025	TBP-class protein binding	IPI	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0003712	transcription coregulator activity	IBA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IBA	biological process
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006366	transcription by RNA polymerase II	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881