• Gene id: 10587

Gene Summary

• Gene Symbol: TXNRD2   Gene   UCSC   Ensembl
• Aliases: GCCD5, SELZ, TR, TR-BETA, TR3, TRXR2
• Gene name: thioredoxin reductase 2
• Alternate names: thioredoxin reductase 2, mitochondrial, selenoprotein Z, thioredoxin reductase 3, thioredoxin reductase TR3, thioredoxin reductase beta,
• Gene location: 22q11.21 (19941817: 19875517)     Exons: 22     NC_000022.11
• Gene summary(Entrez): The protein encoded by this gene belongs to the pyridine nucleotide-disulfide oxidoreductase family, and is a member of the thioredoxin (Trx) system. Three thioredoxin reductase (TrxR) isozymes are found in mammals. TrxRs are selenocysteine-containing fla
• OMIM: 608288

Protein Summary

• Protein general information: Q9NNW7  
  • Name: Thioredoxin reductase 2, mitochondrial (EC 1.8.1.9) (Selenoprotein Z) (SelZ) (TR beta) (Thioredoxin reductase TR3)
  • Length: 524  
  • Mass: 56507
  • Tissue specificity: Highly expressed in the prostate, ovary, liver, testis, uterus, colon and small intestine. Intermediate levels in brain, skeletal muscle, heart and spleen. Low levels in placenta, pancreas, thymus and peripheral blood leukocytes. Accor
• Sequence:

  MAAMAVALRGLGGRFRWRTQAVAGGVRGAARGAAAGQRDYDLLVVGGGSGGLACAKEAAQLGRKVAVVDYVEPSP
  QGTRWGLGGTCVNVGCIPKKLMHQAALLGGLIQDAPNYGWEVAQPVPHDWRKMAEAVQNHVKSLNWGHRVQLQDR
  KVKYFNIKASFVDEHTVCGVAKGGKEILLSADHIIIATGGRPRYPTHIEGALEYGITSDDIFWLKESPGKTLVVG
  ASYVALECAGFLTGIGLDTTIMMRSIPLRGFDQQMSSMVIEHMASHGTRFLRGCAPSRVRRLPDGQLQVTWEDST
  TGKEDTGTFDTVLWAIGRVPDTRSLNLEKAGVDTSPDTQKILVDSREATSVPHIYAIGDVVEGRPELTPIAIMAG
  RLLVQRLFGGSSDLMDYDNVPTTVFTPLEYGCVGLSEEEAVARHGQEHVEVYHAHYKPLEFTVAGRDASQCYVKM
  VCLREPPQLVLGLHFLGPNAGEVTQGFALGIKCGASYAQVMRTVGIHPTCSEEVVKLRISKRSGLDPTVTGCUG

• Structural information:
  • Interpro: IPR036188  IPR023753  IPR016156  IPR001100  IPR004099   IPR012999  IPR006338  
  • Prosite: PS00076
  • PDB: 1W1E
  • PDBsum: 1W1E
  • STRING: ENSP00000383365
• Other Databases: GeneCards:  TXNRD2  Malacards:  TXNRD2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004791	thioredoxin-disulfide reductase activity	IBA	molecular function
GO:0045454	cell redox homeostasis	IBA	biological process
GO:0005739	mitochondrion	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0045454	cell redox homeostasis	IMP	biological process
GO:0004791	thioredoxin-disulfide reductase activity	IEA	molecular function
GO:0016668	oxidoreductase activity, acting on a sulfur group of donors, NAD(P) as acceptor	IEA	molecular function
GO:0050660	flavin adenine dinucleotide binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0045454	cell redox homeostasis	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0004791	thioredoxin-disulfide reductase activity	TAS	molecular function
GO:0004791	thioredoxin-disulfide reductase activity	IEA	molecular function
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0034599	cellular response to oxidative stress	TAS	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0005739	mitochondrion	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0000305	response to oxygen radical	TAS	biological process
GO:0004791	thioredoxin-disulfide reductase activity	ISS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05225	Hepatocellular carcinoma
hsa00450	Selenocompound metabolism

Diseases

Associated diseases	References
Familial glucocorticoid deficiency	KEGG:H00256
Familial glucocorticoid deficiency	KEGG:H00256
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq