• Gene id: 10581

Gene Summary

• Gene Symbol: IFITM2   Gene   UCSC   Ensembl
• Aliases: 1-8D, DSPA2c
• Gene name: interferon induced transmembrane protein 2
• Alternate names: interferon-induced transmembrane protein 2, dispanin subfamily A member 2c, interferon-inducible protein 1-8D,
• Gene location: 11p15.5 (308106: 309409)     Exons: 2     NC_000011.10
• OMIM: 605578

Protein Summary

• Protein general information: Q01629  
  • Name: Interferon induced transmembrane protein 2 (Dispanin subfamily A member 2c) (DSPA2c) (Interferon inducible protein 1 8D)
  • Length: 132  
  • Mass: 14632
• Sequence:

  MNHIVQTFSPVNSGQPPNYEMLKEEQEVAMLGVPHNPAPPMSTVIHIRSETSVPDHVVWSLFNTLFMNTCCLGFI
  AFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGIFMTILLIIIPVLVVQAQR

• Structural information:
  • Interpro: IPR007593  
  • STRING: ENSP00000484689
• Other Databases: GeneCards:  IFITM2  Malacards:  IFITM2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046597	negative regulation of viral entry into host cell	IDA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0035456	response to interferon-beta	IBA	biological process
GO:0046597	negative regulation of viral entry into host cell	IBA	biological process
GO:0034341	response to interferon-gamma	IBA	biological process
GO:0035455	response to interferon-alpha	IBA	biological process
GO:0045071	negative regulation of viral genome replication	IBA	biological process
GO:0051607	defense response to virus	IBA	biological process
GO:0060337	type I interferon signaling pathway	IBA	biological process
GO:0045071	negative regulation of viral genome replication	IDA	biological process
GO:0035455	response to interferon-alpha	IDA	biological process
GO:0034341	response to interferon-gamma	IDA	biological process
GO:0009615	response to virus	IDA	biological process
GO:0009615	response to virus	IDA	biological process
GO:0009615	response to virus	IDA	biological process
GO:0046597	negative regulation of viral entry into host cell	IDA	biological process
GO:0035456	response to interferon-beta	IDA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006955	immune response	TAS	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0060337	type I interferon signaling pathway	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)