• Gene id: 1058

Gene Summary

• Gene Symbol: CENPA   Gene   UCSC   Ensembl
• Aliases: CENP-A, CenH3
• Gene name: centromere protein A
• Alternate names: histone H3-like centromeric protein A, centromere autoantigen A, centromere protein A, 17kDa, centromere-specific histone,
• Gene location: 2p23.3 (26786014: 26794588)     Exons: 5     NC_000002.12
• Gene summary(Entrez): Centromeres are the differentiated chromosomal domains that specify the mitotic behavior of chromosomes. This gene encodes a centromere protein which contains a histone H3 related histone fold domain that is required for targeting to the centromere. Centr
• OMIM: 603606

Protein Summary

• Protein general information: P49450  
  • Name: Histone H3 like centromeric protein A (Centromere autoantigen A) (Centromere protein A) (CENP A)
  • Length: 140  
  • Mass: 15991
• Sequence:

  MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAREIC
  VKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG

• Structural information:
  • Interpro: IPR009072  IPR007125  IPR000164  
  • Prosite: PS00959
  • PDB: 3AN2 3NQJ 3NQU 3R45 3WTP 5CVD 5Z23 6BUZ 6C0W 6E0C 6E0P 6L49 6MUO 6MUP 6O1D 6SE0 6SE6 6SEE 6SEF 6SEG
  • PDBsum: 3AN2 3NQJ 3NQU 3R45 3WTP 5CVD 5Z23 6BUZ 6C0W 6E0C 6E0P 6L49 6MUO 6MUP 6O1D 6SE0 6SE6 6SEE 6SEF 6SEG
  • DIP: 52297
  • STRING: ENSP00000336868
• Other Databases: GeneCards:  CENPA  Malacards:  CENPA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0000788	nuclear nucleosome	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0000775	chromosome, centromeric region	IDA	cellular component
GO:0000132	establishment of mitotic spindle orientation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000281	mitotic cytokinesis	IMP	biological process
GO:0000786	nucleosome	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0000776	kinetochore	IEA	cellular component
GO:0051301	cell division	IEA	biological process
GO:0000786	nucleosome	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0005694	chromosome	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003682	chromatin binding	TAS	molecular function
GO:0000775	chromosome, centromeric region	TAS	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0000775	chromosome, centromeric region	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0034080	CENP-A containing nucleosome assembly	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031618	nuclear pericentric heterochromatin	IEA	cellular component
GO:0000939	condensed chromosome inner kinetochore	IEA	cellular component
GO:0000780	condensed nuclear chromosome, centromeric region	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0000778	condensed nuclear chromosome kinetochore	IDA	cellular component
GO:0000780	condensed nuclear chromosome, centromeric region	IDA	cellular component
GO:0051382	kinetochore assembly	IDA	biological process
GO:0071459	protein localization to chromosome, centromeric region	IDA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0000777	condensed chromosome kinetochore	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005634	nucleus	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray