• Gene id: 10576

Gene Summary

• Gene Symbol: CCT2   Gene   UCSC   Ensembl
• Aliases: 99D8.1, CCT-beta, CCTB, HEL-S-100n, PRO1633, TCP-1-beta
• Gene name: chaperonin containing TCP1 subunit 2
• Alternate names: T-complex protein 1 subunit beta, T-complex protein 1, beta subunit, chaperonin containing TCP1, subunit 2 (beta), chaperonin containing t-complex polypeptide 1, beta subunit, chaperonin containing t-complex polypeptide 1, subunit 2, epididymis secretory sperm,
• Gene location: 12q15 (69585458: 69601569)     Exons: 17     NC_000012.12
• Gene summary(Entrez): The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different p
• OMIM: 605139

Protein Summary

• Protein general information: P78371  
  • Name: T complex protein 1 subunit beta (TCP 1 beta) (CCT beta)
  • Length: 535  
  • Mass: 57488
• Sequence:

  MASLSLAPVNIFKAGADEERAETARLTSFIGAIAIGDLVKSTLGPKGMDKILLSSGRDASLMVTNDGATILKNIG
  VDNPAAKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESLIAKKIHPQTIIAGWREATKAAREALLSSAVDHGS
  DEVKFRQDLMNIAGTTLSSKLLTHHKDHFTKLAVEAVLRLKGSGNLEAIHIIKKLGGSLADSYLDEGFLLDKKIG
  VNQPKRIENAKILIANTGMDTDKIKIFGSRVRVDSTAKVAEIEHAEKEKMKEKVERILKHGINCFINRQLIYNYP
  EQLFGAAGVMAIEHADFAGVERLALVTGGEIASTFDHPELVKLGSCKLIEEVMIGEDKLIHFSGVALGEACTIVL
  RGATQQILDEAERSLHDALCVLAQTVKDSRTVYGGGCSEMLMAHAVTQLANRTPGKEAVAMESYAKALRMLPTII
  ADNAGYDSADLVAQLRAAHSEGNTTAGLDMREGTIGDMAILGITESFQVKRQVLLSAAEAAEVILRVDNIIKAAP
  RKRVPDHHPC

• Structural information:
  • Interpro: IPR012716  IPR017998  IPR002194  IPR002423  IPR027409   IPR027413  IPR027410  
  • Prosite: PS00750 PS00751 PS00995
  • CDD: cd03336
  • PDB: 6NR8 6NR9 6NRA 6NRB 6NRC 6NRD 6QB8
  • PDBsum: 6NR8 6NR9 6NRA 6NRB 6NRC 6NRD 6QB8
  • DIP: 38123
  • STRING: ENSP00000299300
• Other Databases: GeneCards:  CCT2  Malacards:  CCT2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005874	microtubule	IDA	cellular component
GO:0006457	protein folding	NAS	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0051082	unfolded protein binding	NAS	molecular function
GO:0005829	cytosol	NAS	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0005832	chaperonin-containing T-complex	IEA	cellular component
GO:0006457	protein folding	IEA	biological process
GO:0051082	unfolded protein binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005832	chaperonin-containing T-complex	IBA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0051131	chaperone-mediated protein complex assembly	IMP	biological process
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006457	protein folding	TAS	biological process
GO:0035578	azurophil granule lumen	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002199	zona pellucida receptor complex	IEA	cellular component
GO:0005832	chaperonin-containing T-complex	IEA	cellular component
GO:0044297	cell body	IEA	cellular component
GO:1901998	toxin transport	IEA	biological process
GO:0007339	binding of sperm to zona pellucida	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:1904851	positive regulation of establishment of protein localization to telomere	IMP	biological process
GO:1904874	positive regulation of telomerase RNA localization to Cajal body	HMP	biological process
GO:0032212	positive regulation of telomere maintenance via telomerase	IMP	biological process
GO:1904871	positive regulation of protein localization to Cajal body	HMP	biological process
GO:0050821	protein stabilization	IMP	biological process
GO:0090666	scaRNA localization to Cajal body	IMP	biological process
GO:0090666	scaRNA localization to Cajal body	IMP	biological process
GO:0090666	scaRNA localization to Cajal body	IMP	biological process
GO:0051973	positive regulation of telomerase activity	IMP	biological process
GO:0005832	chaperonin-containing T-complex	IDA	cellular component
GO:0051086	chaperone mediated protein folding independent of cofactor	IMP	biological process
GO:0044183	protein folding chaperone	IDA	molecular function
GO:1904874	positive regulation of telomerase RNA localization to Cajal body	IMP	biological process
GO:1904851	positive regulation of establishment of protein localization to telomere	IMP	biological process
GO:0005832	chaperonin-containing T-complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray