• Gene id: 10574

Gene Summary

• Gene Symbol: CCT7   Gene   UCSC   Ensembl
• Aliases: CCTETA, CCTH, NIP7-1, TCP1ETA
• Gene name: chaperonin containing TCP1 subunit 7
• Alternate names: T-complex protein 1 subunit eta, CCT-eta, HIV-1 Nef interacting protein, TCP-1-eta, chaperonin containing t-complex polypeptide 1, eta subunit,
• Gene location: 2p13.2 (31527899: 31528803)     Exons: 4     NC_000016.10
• Gene summary(Entrez): This gene encodes a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded
• OMIM: 605140

Protein Summary

• Protein general information: Q99832  
  • Name: T complex protein 1 subunit eta (TCP 1 eta) (CCT eta) (HIV 1 Nef interacting protein) [Cleaved into: T complex protein 1 subunit eta, N terminally processed]
  • Length: 543  
  • Mass: 59367
• Sequence:

  MMPTPVILLKEGTDSSQGIPQLVSNISACQVIAEAVRTTLGPRGMDKLIVDGRGKATISNDGATILKLLDVVHPA
  AKTLVDIAKSQDAEVGDGTTSVTLLAAEFLKQVKPYVEEGLHPQIIIRAFRTATQLAVNKIKEIAVTVKKADKVE
  QRKLLEKCAMTALSSKLISQQKAFFAKMVVDAVMMLDDLLQLKMIGIKKVQGGALEDSQLVAGVAFKKTFSYAGF
  EMQPKKYHNPKIALLNVELELKAEKDNAEIRVHTVEDYQAIVDAEWNILYDKLEKIHHSGAKVVLSKLPIGDVAT
  QYFADRDMFCAGRVPEEDLKRTMMACGGSIQTSVNALSADVLGRCQVFEETQIGGERYNFFTGCPKAKTCTFILR
  GGAEQFMEETERSLHDAIMIVRRAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPRQLC
  DNAGFDATNILNKLRARHAQGGTWYGVDINNEDIADNFEAFVWEPAMVRINALTAASEAACLIVSVDETIKNPRS
  TVDAPTAAGRGRGRGRPH

• Structural information:
  • Interpro: IPR012720  IPR017998  IPR002194  IPR002423  IPR027409   IPR027413  IPR027410  
  • Prosite: PS00750 PS00751 PS00995
  • CDD: cd03340
  • PDB: 6NR8 6NR9 6NRA 6NRB 6NRC 6NRD 6QB8
  • PDBsum: 6NR8 6NR9 6NRA 6NRB 6NRC 6NRD 6QB8
  • DIP: 51608
  • STRING: ENSP00000258091
• Other Databases: GeneCards:  CCT7  Malacards:  CCT7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005832	chaperonin-containing T-complex	IBA	cellular component
GO:0005832	chaperonin-containing T-complex	IDA	cellular component
GO:0006457	protein folding	IEA	biological process
GO:0051082	unfolded protein binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0051082	unfolded protein binding	TAS	molecular function
GO:0005737	cytoplasm	TAS	cellular component
GO:0006457	protein folding	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006457	protein folding	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005832	chaperonin-containing T-complex	IEA	cellular component
GO:0044297	cell body	IEA	cellular component
GO:1901998	toxin transport	IEA	biological process
GO:0007339	binding of sperm to zona pellucida	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0050821	protein stabilization	IMP	biological process
GO:0005832	chaperonin-containing T-complex	TAS	cellular component
GO:0032212	positive regulation of telomere maintenance via telomerase	IMP	biological process
GO:1904871	positive regulation of protein localization to Cajal body	HMP	biological process
GO:1904874	positive regulation of telomerase RNA localization to Cajal body	HMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:1904851	positive regulation of establishment of protein localization to telomere	IMP	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005874	microtubule	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)