• Gene id: 10573

Gene Summary

• Gene Symbol: MRPL28   Gene   UCSC   Ensembl
• Aliases: MAAT1, p15
• Gene name: mitochondrial ribosomal protein L28
• Alternate names: 39S ribosomal protein L28, mitochondrial, L28mt, MRP-L28, melanoma antigen p15, melanoma-associated antigen recognised by cytotoxic T lymphocytes, melanoma-associated antigen recognized by T-lymphocytes, mitochondrial large ribosomal subunit protein bL28m,
• Gene location: 16p13.3 (370537: 366968)     Exons: 6     NC_000016.10
• Gene summary(Entrez): Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
• OMIM: 604034

Protein Summary

• Protein general information: Q13084  
  • Name: 39S ribosomal protein L28, mitochondrial (L28mt) (MRP L28) (Melanoma antigen p15) (Melanoma associated antigen recognized by T lymphocytes) (Mitochondrial large ribosomal subunit protein bL28m)
  • Length: 256  
  • Mass: 30157
  • Tissue specificity: Found in a variety of normal tissues including spleen, testes, thymus, liver, kidney, brain, adrenal, lung and retinal tissue.
• Sequence:

  MPLHKYPVWLWKRLQLREGICSRLPGHYLRSLEEERTPTPVHYRPHGAKFKINPKNGQRERVEDVPIPIYFPPES
  QRGLWGGEGWILGQIYANNDKLSKRLKKVWKPQLFEREFYSEILDKKFTVTVTMRTLDLIDEAYGLDFYILKTPK
  EDLCSKFGMDLKRGMLLRLARQDPQLHPEDPERRAAIYDKYKEFAIPEEEAEWVGLTLEEAIEKQRLLEEKDPVP
  LFKIYVAELIQQLQQQALSEPAVVQKRASGQ

• Structural information:
  • Interpro: IPR034704  IPR026569  IPR037147  
  • PDB: 3J7Y 5OOL 5OOM 6NU2 6NU3
  • PDBsum: 3J7Y 5OOL 5OOM 6NU2 6NU3
  • DIP: 61135
  • STRING: ENSP00000199706
• Other Databases: GeneCards:  MRPL28  Malacards:  MRPL28

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005762	mitochondrial large ribosomal subunit	IBA	cellular component
GO:0003735	structural constituent of ribosome	IBA	molecular function
GO:0005761	mitochondrial ribosome	IDA	cellular component
GO:0005762	mitochondrial large ribosomal subunit	IDA	cellular component
GO:0005762	mitochondrial large ribosomal subunit	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0003735	structural constituent of ribosome	IEA	molecular function
GO:0005840	ribosome	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0070125	mitochondrial translational elongation	TAS	biological process
GO:0070126	mitochondrial translational termination	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0006412	translation	NAS	biological process
GO:0003735	structural constituent of ribosome	NAS	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0005761	mitochondrial ribosome	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03010	Ribosome

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq